Identifiers and Description

Gene Model Identifier

SteCoe_10073

Standard Name

None

Aliases

None

Description

Chitin_synth_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19394.0.g621.0806392777072785e-30Chitin synthase

Saccharomyces CerevisiaeYBR038W2.9374821117108028e-30Chitin synthase II; catalyzes
transfer of N-acetylglucosamin
e (GlcNAc) to chitin upon acti
vation of zymogenic form; requ
ired for chitin synthesis in t
he primary septum during cytok
inesis; localization regulated
by Cdk1p during mitosis; phos
phorylation by Dbf2p kinase re
gulates its dynamics and chiti
n synthesis during cytokinesis
Tetrahymena ThermophilaTTHERM_005999405.900090541597061e-29Chitin synthase family protein
WormBaseWBGene000004970.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10073(Protein)
MCERNADILATKEYIKYCDMKVNRPINHLSLKFFSENVVYQPFVLRYQERNKVNGLFPLA
SMPAIRNQEIKCDFLRDWTSNGQQNNNQSYFNQRDSANATFIDANEENKISSVLSKNCKF
LIVITICNEKAKELDDTLNGIFCNLKNFIHGKEGYKCKLNEIGCIIVADGIEAFNKSYKA
QHNTINNKCEVCDLDKNFIKAHSEKCGNFLYFSQFFNEHCIENFFAEQEIFEEMIKESEV
IEKILNVNENFRYIFREIYRMEEEKIIEESKDSDKNKIDEEDKEEGSSDKEDKEERSSDK
EEVKEEIKFNFSRDNEKICKLHDILFSLLSLPKQYINLFKDSPTKKATLNSELIKSDKEI
KSKIKNLGKHYNILRNCAHISDEYYDLAIKFLQIFNLQEYIMKAWINEQEEILINILPHR
EEDNNVVYLFIKDINYEKEETYSEEAFDEIFENKYSNCEIDYAKDFIYGLIQKYIEKCKS
LNDYLEKISKLKYCEKKWIEKSDXDYAKDFIYGLIQKYIEKCKSLNDYLEKISKLKYCEK
KWIEKSDSRIIETNEILKKLKSSRNKHSEMYKDEENERQMETINENIIRLTKSTGFMKPD
PYSERGMPKTKSHMNIKDEHETEMEDLINERHKFNKEHKSYLEKISDLHPEEKKKYEFTL
IKKLKDLKYIKENEEIAHCFSMKLSFSDDEEQKEQVDRSMQNELGISIINDSSCNINRQN
QSNEPFLNLIFCVKQLNKRKLNSHRWFLEGFCSIINPNFIMFLDVGTIPKNNSLYSLYYA
MAKDEYLAGCCGEIIPIKPKNCNMVVNAQIVEYKFSHILDKALESVIGYVSVLPGAFSAY
RWKCFDTKILSKYFHSQYNQEMSLFEANMYLAEDRILCLELMCMKNEKYILRYVNESQAE
TDTPETLDRLMAQRRRWINGSWFSMIYTITKCNKIGKSKHKCLIKFIFRILMVYYAIVAM
FNWVLVGAFYIGFAISLKKNINEKSSNVDKLLNISTPFIIIYIAILIFITIASLSVSPTK
LEKVFKVISYIYGLYTLGTIGLIFSFIYKSNVVENIIVNHAWKTSISLVSIGIIVFFFVI
VICLNYKSIAPILLGLFHFLFMTGTYVNVFLIYSICNFHDCSWGNRPDNKTEAEKLTEAQ
YKNERTRFVMFWILCNGFFVYAVELLYNSDDDYSHYYLNSVASLAFLIMVIKCIGGIMYF
FCEKCYHRWLIR


>SteCoe_10073(CDS)
ATGTGTGAAAGAAATGCTGATATACTTGCTACTAAGGAATACATCAAATACTGTGATATG
AAAGTAAATAGACCAATAAATCATTTAAGTTTGAAATTTTTTTCTGAGAATGTAGTTTAT
CAACCTTTTGTCTTACGATATCAAGAAAGAAATAAAGTTAATGGACTTTTTCCTCTTGCG
TCAATGCCAGCTATAAGAAATCAAGAAATCAAATGCGATTTTTTAAGAGACTGGACTAGT
AATGGTCAACAAAATAATAATCAAAGTTATTTTAATCAAAGAGATAGTGCGAATGCTACA
TTTATAGATGCTAATGAGGAAAATAAAATTTCAAGTGTTCTTTCAAAAAATTGCAAGTTT
CTTATAGTTATCACAATATGCAATGAAAAGGCAAAAGAACTTGATGATACTTTAAATGGC
ATTTTTTGCAATTTGAAAAATTTTATTCATGGCAAAGAAGGGTATAAATGCAAATTAAAT
GAAATTGGTTGTATTATCGTTGCTGATGGTATTGAGGCTTTTAATAAATCTTATAAGGCA
CAGCACAATACTATCAATAATAAGTGTGAAGTTTGTGATTTGGATAAAAATTTTATAAAG
GCACATAGTGAAAAATGTGGGAATTTTTTGTATTTTTCACAGTTTTTTAATGAACATTGT
ATTGAAAATTTTTTTGCTGAGCAGGAAATTTTTGAAGAAATGATTAAAGAATCAGAAGTA
ATAGAAAAAATACTTAATGTCAATGAGAACTTTAGATATATATTTAGAGAGATTTATAGA
ATGGAAGAAGAAAAAATAATTGAAGAAAGCAAAGATAGTGATAAAAATAAAATTGATGAA
GAAGATAAAGAAGAGGGATCTTCGGATAAAGAAGATAAAGAAGAGAGATCTTCGGATAAA
GAGGAAGTTAAGGAAGAAATAAAATTTAATTTCTCTAGAGACAATGAAAAAATATGTAAA
CTTCATGATATTTTATTTTCATTACTGAGCCTTCCAAAGCAATACATTAATCTATTCAAA
GACAGCCCGACTAAAAAAGCTACCTTGAATTCTGAGCTTATAAAAAGCGACAAAGAAATA
AAATCAAAAATCAAAAATCTAGGTAAACATTATAATATTCTAAGAAATTGTGCACATATT
TCAGATGAATATTATGATCTTGCAATCAAATTCCTTCAAATTTTCAACCTCCAAGAATAT
ATAATGAAAGCATGGATAAATGAACAAGAAGAAATCTTAATTAATATCCTTCCTCATAGA
GAAGAAGATAATAATGTTGTTTACTTATTTATAAAAGATATAAACTATGAAAAAGAAGAA
ACTTATTCAGAAGAAGCATTTGATGAAATTTTTGAAAATAAATATAGTAATTGTGAAATC
GATTATGCAAAAGATTTTATATATGGATTAATTCAAAAATATATTGAAAAGTGTAAAAGT
TTAAATGATTATTTAGAAAAAATATCGAAACTTAAATATTGTGAAAAGAAATGGATTGAA
AAGTCTGACNTCGATTATGCAAAAGATTTTATATATGGATTAATTCAAAAATATATTGAA
AAGTGTAAAAGTTTGAATGATTATTTAGAAAAAATATCGAAACTTAAATATTGTGAAAAG
AAATGGATTGAAAAGTCTGATTCAAGAATAATTGAGACTAATGAGATTTTAAAGAAATTA
AAAAGTAGTAGGAATAAGCATAGTGAAATGTATAAAGATGAAGAGAATGAGAGACAAATG
GAGACTATAAATGAAAATATAATTCGATTAACTAAAAGCACAGGATTTATGAAACCAGAT
CCTTATAGTGAAAGAGGTATGCCTAAGACTAAATCGCATATGAATATAAAAGATGAGCAT
GAAACAGAAATGGAAGATCTGATAAATGAAAGACATAAATTCAACAAAGAGCATAAAAGT
TATCTAGAAAAAATCTCTGATCTTCATCCTGAAGAAAAGAAAAAATATGAGTTTACATTG
ATTAAAAAGCTAAAAGACTTAAAATATATAAAAGAAAACGAAGAAATAGCCCACTGCTTT
AGTATGAAACTTAGTTTTTCAGATGATGAAGAACAAAAAGAACAAGTCGATAGATCTATG
CAAAACGAATTAGGAATATCAATAATTAATGATTCGAGTTGCAACATAAACAGACAAAAT
CAATCAAATGAACCTTTCCTCAATCTGATTTTTTGTGTGAAGCAGCTAAACAAACGAAAA
TTAAATTCTCATAGATGGTTCTTAGAAGGATTTTGTAGTATTATCAATCCAAATTTTATA
ATGTTTCTTGATGTTGGAACAATACCAAAAAACAATAGCCTATATAGTCTTTATTATGCT
ATGGCAAAAGATGAATATTTAGCAGGATGCTGTGGAGAAATTATCCCTATTAAACCAAAA
AATTGTAATATGGTAGTAAACGCTCAAATAGTCGAATACAAATTTTCACATATCCTAGAC
AAGGCTCTTGAAAGTGTTATTGGCTATGTATCAGTTCTTCCAGGAGCTTTTAGTGCATAT
AGATGGAAATGTTTTGATACTAAAATATTAAGTAAATATTTCCATTCTCAATACAATCAA
GAAATGTCTCTTTTTGAAGCAAATATGTATTTGGCTGAAGATAGGATATTATGTTTAGAA
CTTATGTGTATGAAAAATGAAAAATATATTTTAAGGTATGTCAATGAGTCACAAGCTGAA
ACTGATACCCCTGAAACACTTGATAGATTAATGGCACAAAGGAGAAGATGGATAAATGGT
TCATGGTTTTCTATGATATACACCATTACTAAATGTAATAAAATAGGTAAATCAAAACAC
AAATGTTTAATAAAATTTATTTTCAGGATTTTGATGGTTTATTATGCGATTGTTGCAATG
TTTAATTGGGTTCTAGTTGGAGCATTTTATATTGGCTTTGCGATATCTTTAAAAAAAAAT
ATCAATGAGAAATCGTCTAATGTTGACAAACTTTTGAATATATCAACACCATTTATTATC
ATTTATATAGCTATTCTTATATTTATAACTATTGCATCTTTATCTGTATCTCCTACAAAG
CTTGAAAAAGTCTTTAAGGTAATATCATATATTTATGGTTTATATACACTTGGCACAATT
GGATTAATCTTTAGTTTCATTTATAAAAGCAATGTTGTTGAAAATATTATTGTAAACCAT
GCATGGAAAACCTCAATATCTTTAGTTTCAATAGGAATTATAGTATTTTTTTTTGTAATT
GTAATATGTTTAAATTACAAAAGTATAGCTCCAATACTTTTAGGGTTATTTCATTTTTTG
TTTATGACTGGGACATATGTTAATGTTTTTTTAATCTATTCAATATGTAATTTTCATGAC
TGTTCTTGGGGAAATAGACCAGATAATAAAACTGAAGCTGAAAAACTTACGGAAGCACAA
TATAAAAATGAAAGAACTAGATTTGTTATGTTTTGGATTTTATGTAATGGTTTTTTTGTA
TATGCTGTAGAGTTACTTTATAATAGTGATGATGATTATAGTCATTATTATTTAAATAGT
GTTGCATCCTTAGCTTTTCTGATTATGGTTATTAAATGTATAGGAGGAATTATGTACTTT
TTCTGTGAGAAATGCTATCATCGATGGTTGATAAGATAA