Identifiers and Description

Gene Model Identifier

SteCoe_10104

Standard Name

None

Aliases

None

Description

Ribosomal_L32e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYBL092W2.1151310375910805e-19Ribosomal 60S subunit protein
L32; overexpression disrupts t
elomeric silencing; homologous
to mammalian ribosomal protei
n L32, no bacterial homolog
Tetrahymena ThermophilaTTHERM_000851801.5628821893349888e-18Homolog of yeast RPL32, human
RPL32
WormBaseWBGene000044461.5628821893349888e-18
Oxytricha TrifallaxContig20794.0.g550.0000000000006914400106940203Ribosomal protein L32

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10104(Protein)
MVAPIHMLKKIKKHKKTFTRFQSDQFKRVGPSWRQPHGIDSRIRRKFRGNKPLPGIGYGT
DKKTRFLLPNGFRKFLVTNDKDLEVLLMHNRVYCAELAHNLSARSRKRLVERAAQLGVRV
TNANARVRTEEKK


>SteCoe_10104(CDS)
ATGGTAGCCCCTATCCACATGCTTAAGAAGATCAAAAAGCATAAGAAAACTTTCACCAGA
TTCCAAAGCGACCAGTTCAAGAGAGTTGGACCAAGTTGGAGACAGCCTCATGGTATTGAC
AGCAGAATCCGAAGAAAGTTTAGAGGGAATAAACCTTTACCTGGTATTGGATATGGTACT
GATAAGAAAACTAGATTTTTACTGCCAAATGGTTTTAGGAAATTCTTAGTCACTAACGAT
AAGGATTTAGAAGTGCTTCTTATGCATAATAGAGTTTATTGTGCTGAACTTGCACATAAT
CTTAGTGCCAGGAGCAGGAAAAGATTAGTTGAAAGAGCTGCACAGCTTGGAGTCAGAGTC
ACGAATGCCAATGCTAGAGTTCGCACTGAGGAAAAAAAATAA