Identifiers and Description

Gene Model Identifier

SteCoe_10131

Standard Name

None

Aliases

None

Description

PhoLip_ATPase_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11080.0.g1180haloacid dehalogenase-like hyd
rolase

WormBaseWBGene000191660

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10131(Protein)
MQESLIDKIEGPNRRSTTLVSANRYVVLPVEGVNMFMKNSISTSKYNAVTFLPKNMMEQF
RKIANVYFVIIAVLQSIPDISNSGGVPNILLPLGLVLTISAIKDMLEDRKRKKSDNEENN
RKALVRKNASWQTVLWKDIKVGDIVKVIKDEKFPADLVMLSSSDEKGICYIETKNLDGET
NLKHKVASKSTQSLYCDEQALDSLRGDIKCEDPNPMIYQFQGVLKLPGGITAASSEQFLL
RGSSLKNTDWITGITIYTGHESKIMLNSSQSKVKFSSNEKQMNNQIIYLFFMQLVLCAFC
AVFNVSWLSNQKDNATYLELEKANTNIPYNFVVNFFSWMLLFSNFVPISLLVTLEMVKFI
QAIFIAWDLDLYFEETDMPAGVQSSNLNEELGQIHYLFSDKTGTLTCNIMEFKKITVNGN
SYGTDLHLSSTDKIPHVDFVDSSFDPKHPNNFEFLLHLACCHTIVTEKKDGVIEYKASSP
DELALVNAAKFFGFEFIGRDADQNIELKVFGQFYKVSLLNIIEFNSDRKRMTVVIRLPDG
RVKVFCKGADTIILPRLLPDATIDKTFQHLENYGKVGLRTLLIASRELSESEYDEWNATF
IDAMNDIHYRDKKIAECGERIEIKMNLLGATAIEDRLQDGVPDTIAFLRKAGIKVWVLTG
DKIETAINIGFSCNLLTQEMAQLLVTSARTKDVENEVKEALDNLSTLGGKETALIVSGES
LLKIRGDLKKIFIKVCERCKVVIACRVSPQQKADIVKMIRDFKPDARTLSIGDGANDVNM
ITAAHVGVGIAGLEGKQAVRASDYSIAQFSYLKKLLFVHGRECYRRNSTLICFNFYKNVL
LVMPLFFYGMFSVFSGQSFYNTWIYQLFNLFFASGPIVIYAVIDKEMDYKKLLSDPVYYK
IGLIGELFSTQKFWEWILEAIAQSMFILIVSVFALCDITGMKNTGKIDPMSVAAVMVYGL
VVTFVNVKVLLFSYAHTVFSIGVIILSIMSYYFISAIITDWMPINETLDNFDSYGATGMM
LSNPNSYIAFIIVIYSGFFWQPMYSFIKVVFERALTNKTSPKDKQSISMSEAINIYEESK
EKPDFMKLRRRNFYIDTGYAFSGEAGHAPQLTDPSFFK


>SteCoe_10131(CDS)
ATGCAAGAGAGCCTTATAGATAAAATCGAAGGCCCTAATAGAAGGTCAACAACTCTTGTC
TCAGCTAATAGATATGTTGTTCTGCCAGTTGAAGGAGTGAATATGTTTATGAAGAATTCA
ATCAGCACAAGCAAGTATAATGCTGTTACCTTCCTTCCTAAAAATATGATGGAGCAGTTC
AGAAAGATAGCTAATGTGTATTTTGTTATTATTGCAGTGTTACAATCTATACCTGATATC
TCAAATTCTGGAGGAGTTCCTAATATTCTTTTGCCGCTTGGCCTTGTCTTGACTATATCT
GCAATAAAAGATATGCTAGAAGACCGTAAGCGTAAGAAGTCTGATAATGAGGAGAATAAT
CGTAAAGCTTTGGTTAGGAAAAATGCTTCTTGGCAAACTGTTTTGTGGAAAGATATAAAA
GTTGGAGACATTGTTAAGGTAATAAAAGATGAAAAGTTCCCAGCAGACTTAGTAATGCTA
AGCTCAAGTGACGAAAAAGGCATTTGCTACATTGAGACCAAGAATTTAGATGGCGAGACT
AACCTCAAACATAAAGTGGCTTCAAAAAGTACACAAAGCCTTTACTGTGATGAGCAAGCT
CTAGACTCATTGCGTGGGGATATCAAATGTGAAGACCCAAACCCAATGATTTACCAATTT
CAAGGGGTCCTCAAGCTCCCAGGTGGTATAACTGCAGCCTCATCAGAGCAATTTCTCCTA
AGAGGTAGTTCACTAAAAAACACCGACTGGATAACAGGAATAACAATCTACACTGGCCAC
GAATCCAAAATTATGCTCAATTCAAGCCAAAGTAAAGTCAAATTCTCATCTAACGAAAAG
CAAATGAACAACCAAATCATCTATCTTTTCTTCATGCAACTAGTTCTCTGTGCATTTTGC
GCAGTTTTTAATGTTAGCTGGCTTAGTAATCAAAAAGACAATGCTACATATTTGGAATTA
GAAAAAGCTAATACGAACATTCCTTATAATTTCGTCGTGAACTTTTTTTCCTGGATGCTT
TTGTTTAGCAATTTTGTCCCAATTAGTCTACTTGTCACATTAGAAATGGTCAAGTTTATT
CAAGCTATTTTTATAGCTTGGGATTTGGATTTGTATTTCGAAGAGACTGATATGCCTGCC
GGGGTTCAAAGTTCGAATTTGAATGAGGAACTTGGTCAGATTCATTATTTGTTTTCTGAT
AAAACAGGGACTTTGACTTGTAATATTATGGAATTTAAGAAAATTACTGTTAATGGAAAT
TCTTATGGAACTGATCTTCATTTATCGTCAACCGATAAGATTCCTCATGTGGACTTTGTT
GATTCCTCATTTGATCCTAAACACCCAAATAATTTTGAGTTTTTGCTACATTTGGCTTGT
TGTCATACAATTGTTACTGAGAAAAAAGATGGGGTTATTGAGTATAAGGCTAGCAGTCCT
GATGAACTTGCTTTGGTTAATGCAGCTAAATTTTTTGGCTTCGAGTTCATCGGCAGAGAC
GCTGACCAAAATATCGAGCTAAAAGTATTCGGTCAATTCTATAAAGTATCATTACTAAAC
ATAATCGAGTTCAACAGTGATCGTAAAAGAATGACTGTGGTAATCCGACTTCCTGACGGC
CGAGTGAAAGTCTTTTGCAAAGGAGCTGACACAATAATTCTTCCAAGATTACTCCCAGAT
GCCACAATCGATAAAACTTTCCAACATCTCGAAAATTACGGTAAAGTTGGTCTTCGGACC
CTTCTTATAGCAAGTCGTGAACTCTCAGAAAGTGAATACGATGAGTGGAACGCAACCTTC
ATAGATGCAATGAATGATATCCACTACAGAGACAAAAAAATTGCTGAATGTGGAGAAAGA
ATCGAAATAAAAATGAATCTACTTGGGGCAACAGCAATAGAAGACCGTCTTCAGGATGGT
GTTCCTGATACAATAGCTTTTTTAAGAAAAGCTGGAATTAAAGTATGGGTTTTAACAGGA
GATAAAATTGAAACTGCTATAAATATCGGATTTTCATGTAATTTACTAACCCAAGAAATG
GCCCAATTACTAGTAACTAGTGCTAGAACTAAAGATGTAGAAAATGAAGTTAAAGAGGCA
CTTGATAACTTATCAACACTTGGGGGAAAAGAAACAGCTTTAATAGTTTCTGGTGAGAGT
TTATTGAAAATTCGTGGTGATCTGAAAAAAATCTTTATTAAAGTATGTGAAAGATGCAAA
GTAGTTATTGCATGCAGAGTTAGTCCTCAACAAAAAGCTGATATTGTGAAGATGATTAGG
GATTTTAAACCTGATGCTAGAACTTTAAGTATTGGAGATGGGGCTAATGATGTAAATATG
ATTACAGCTGCTCATGTTGGGGTGGGTATTGCTGGACTTGAAGGGAAACAAGCTGTTAGG
GCATCTGATTATTCAATAGCTCAGTTTTCGTATTTAAAAAAACTACTTTTCGTCCATGGC
CGCGAGTGCTATCGTAGAAATTCCACTTTGATCTGTTTTAATTTCTATAAAAATGTCCTC
CTTGTCATGCCTTTGTTCTTTTACGGGATGTTTTCTGTGTTTTCTGGTCAGAGTTTTTAT
AACACATGGATTTACCAGCTATTTAATCTGTTTTTCGCTTCTGGGCCGATTGTTATTTAT
GCGGTTATTGATAAAGAAATGGACTATAAGAAACTGCTTTCGGATCCAGTATATTATAAA
ATTGGCCTGATTGGAGAACTTTTTAGTACTCAGAAATTCTGGGAATGGATTCTTGAAGCT
ATAGCCCAGTCTATGTTCATTTTAATTGTAAGTGTTTTTGCTCTATGCGATATTACTGGT
ATGAAAAACACTGGGAAAATCGACCCTATGTCAGTAGCTGCAGTTATGGTCTATGGACTT
GTTGTAACTTTTGTCAATGTTAAGGTATTACTTTTTAGCTATGCCCACACAGTATTTTCT
ATTGGGGTTATCATTCTAAGTATTATGAGTTATTATTTCATATCTGCAATTATAACAGAC
TGGATGCCCATAAACGAAACTCTAGATAATTTCGACAGCTATGGTGCTACAGGAATGATG
CTTTCAAATCCAAACTCTTATATTGCATTTATAATTGTAATCTACTCAGGGTTCTTCTGG
CAACCCATGTACTCTTTCATTAAGGTAGTTTTTGAGCGAGCTCTTACAAATAAAACCTCA
CCAAAAGATAAACAAAGCATCAGCATGTCTGAGGCAATTAACATCTATGAAGAATCCAAA
GAAAAGCCTGATTTCATGAAACTCAGACGACGTAATTTTTATATAGATACCGGATATGCC
TTTAGTGGTGAAGCAGGTCATGCACCGCAGCTAACCGATCCATCTTTCTTTAAGTAG