Identifiers and Description

Gene Model Identifier

SteCoe_10164

Standard Name

None

Aliases

None

Description

SMC_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19312.0.g1121.0112214926104486e-43RecF/RecN/SMC N terminal domai
n

Saccharomyces CerevisiaeYLR086W4.359610000063081e-28Subunit of the condensin compl
ex; condensin reorganizes chro
mosomes during both mitosis an
d meiosis; forms a subcomplex
with Smc2p that has ATP-hydrol
yzing and DNA-binding activity
, but other condensin subunits
are required for chromatin bi
nding; required for tRNA gene
clustering at the nucleolus; p
otential Cdc28p substrate
WormBaseWBGene000048741.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10164(Protein)
MEIDKIPGRLMIEKVVLKNFKSYAGEKVIGPFHKSLTSVVGPNGSGKSNLLESLLFAFGK
RARKMRLKKLSELIHHSHTHPNLTEASVEVHFLNIIDKENDSYDSVPNSKLILSRIVKKN
NTSEYRLDGRTSTYEEVTCMLKYRGIDLEHNRFLILQGEVEQIAMMKPKAPLGDENKTGL
LEYLEEIIGTDKYVPDIEKAEKELETIGDDVASKKMRFEEIKKVCDQLEAPMKEAVSYIE
TEKESYSFKCLKCRLEKQSRVLKGQRITEGISDQDRKLTEIEQLFNQKRKENESAIAEYE
KKVNERENVRRKIAELQKSINATLTKDAKTVETLKLLKSSMENLEKEIEINTKRCSDINK
DITVLSQGIPEKAELLRQIKDLRQAKEQEFHVKEVEIEQITQELQTKKKVLENERAPIKR
EMNKLVSEKDSKINEIAELEKEIKSSDIEKENAIQSIRTIEENIEKAQKELNETKEVSSN
FIKDTTDKQERLEALKAKALEKNQALRIAGDKITCYEREEKKAYETKSQLSEILRAKMEK
RLLGVHGRLGDLGSINSTYDIAVSTAIGGLDYIVVDTVSNGNEVINYVREKNLGKVSIIV
LEKMNNNDRYIKNFTCPSTEAVRLFDQIQITDNRFRHAFYHVFNDTLFTNNIEDARRIAL
GEKRYKVVTKDGDIINPSGEMRGFANPTKGKMKIIGHSKSVLEVDIQAVKREYKNIQEEL
ENINKEKSELETEINEYKKREREYKQKINLVNNNLNSLIERLNAMKGRLDTLNARSIDDM
HAQVKKLQTLLGKITESVNKTEIIIKKKDALITDIDGRIEEAAGNEFRTLKAEVKRLLTE
EEASEKAFSKAEATLVQRKKDIETRTKQLEKDAAELEENKRQYDKVNKERNEYTQKAHEK
VAEMENLTVLVQEKENKINELEAQKMEITKQFDDILKSRDLVKQKKKELAGELKAVSDEI
QKWQIKLEHTIEDYKNIERDYSNFLQGMVLDQQNQSNLEHQSRKNRLGEERSNLIRPVDW
DASEAELNELIPKIKIIEDIEKYIEAELSSNRPNLNVIQEYKQKSDDKNQKENILNEAKQ
KENDLKTLYTDFKNKRFNEFTKGFREISEKLREMYTKLTRGGNAELEFADSTDPFSEGIV
FTVRPPSKNWKKMANLSGGEKTLSSLALVFALHHYKPNSLYVMDEVDAALDFQNVSVIAN
YIKGETKNAQFIVVSLRYQMFEVADQLVGIYKTKDVSHSLCVSPYSLKEMGNENPIVRQT
LENISMKEN


>SteCoe_10164(CDS)
ATGGAAATTGATAAAATCCCAGGAAGACTTATGATCGAAAAAGTAGTCCTCAAGAACTTT
AAATCCTACGCCGGAGAAAAAGTTATCGGACCCTTCCACAAGTCTTTAACTTCAGTCGTT
GGCCCGAATGGATCGGGAAAATCCAACCTTCTGGAGTCTTTACTATTCGCTTTTGGAAAG
CGCGCCAGAAAAATGCGTCTTAAGAAACTCTCAGAACTCATCCATCATTCTCACACTCAT
CCAAATCTGACAGAAGCAAGCGTTGAAGTACATTTTCTCAACATTATCGATAAGGAAAAC
GATAGTTATGATTCTGTTCCAAATTCAAAATTAATTTTATCAAGAATTGTCAAGAAAAAT
AATACTTCAGAATATCGTTTAGATGGAAGAACATCAACATATGAAGAAGTTACATGCATG
TTGAAATATAGAGGTATAGATTTAGAACATAATAGATTCTTGATATTACAAGGTGAAGTT
GAACAAATTGCCATGATGAAACCTAAAGCCCCATTAGGAGATGAGAATAAAACTGGGCTT
TTAGAGTATTTAGAAGAGATAATTGGAACAGATAAATATGTTCCTGATATAGAAAAAGCA
GAGAAAGAATTAGAGACAATTGGTGATGATGTAGCATCAAAAAAAATGAGGTTTGAAGAA
ATTAAAAAAGTTTGTGATCAACTTGAAGCTCCTATGAAAGAAGCAGTTTCGTATATTGAA
ACTGAGAAAGAGTCTTATAGTTTTAAATGTCTTAAGTGTCGCTTAGAAAAACAGTCACGT
GTACTTAAAGGGCAAAGAATTACTGAAGGGATAAGCGATCAAGATAGAAAACTTACTGAA
ATCGAACAACTTTTTAATCAGAAAAGAAAAGAAAATGAGTCTGCGATAGCTGAATATGAA
AAAAAAGTAAACGAACGCGAAAATGTTAGACGTAAAATTGCGGAATTACAAAAATCAATC
AATGCCACTTTGACTAAAGATGCGAAAACTGTTGAAACCTTAAAACTCTTAAAAAGCTCT
ATGGAAAATCTTGAAAAAGAAATAGAAATCAATACAAAAAGATGTAGTGATATTAATAAA
GATATAACTGTGTTAAGTCAAGGAATACCTGAAAAAGCTGAATTGCTACGTCAAATCAAA
GATCTTCGTCAAGCTAAAGAACAGGAATTTCATGTAAAAGAGGTAGAAATTGAACAAATC
ACCCAAGAGTTACAAACAAAGAAAAAAGTGTTAGAAAATGAGCGGGCACCAATTAAAAGG
GAAATGAATAAACTTGTGAGTGAAAAGGATTCAAAAATAAACGAGATTGCTGAGTTAGAA
AAAGAAATCAAAAGCAGTGATATTGAAAAAGAAAATGCGATACAAAGCATAAGGACTATA
GAAGAGAATATAGAAAAAGCTCAAAAAGAACTTAATGAGACTAAAGAAGTTTCTAGTAAT
TTTATTAAAGATACAACAGATAAGCAAGAGAGACTAGAAGCTTTGAAAGCTAAAGCATTA
GAAAAAAATCAAGCTTTAAGAATAGCTGGGGATAAAATTACCTGTTACGAAAGGGAAGAA
AAAAAAGCATATGAGACTAAAAGCCAACTAAGTGAAATTCTTAGAGCAAAAATGGAAAAA
AGACTCTTAGGTGTTCATGGAAGACTTGGTGATTTGGGTTCAATAAACTCTACATATGAT
ATTGCTGTATCAACAGCTATTGGAGGCTTAGATTATATAGTCGTTGATACAGTGTCAAAT
GGTAATGAAGTTATCAATTATGTCAGGGAAAAAAACCTAGGTAAAGTTAGTATTATCGTC
TTAGAAAAAATGAATAACAACGATCGATATATTAAAAATTTTACTTGTCCAAGTACTGAA
GCTGTTAGATTATTTGATCAAATACAAATTACTGATAATCGATTTAGACATGCATTTTAT
CATGTATTTAACGATACACTTTTTACTAATAACATAGAAGATGCTAGGAGAATAGCATTA
GGGGAAAAAAGATATAAAGTTGTGACTAAAGATGGGGATATCATAAACCCAAGTGGTGAA
ATGAGAGGTTTTGCTAACCCTACTAAAGGTAAAATGAAGATTATTGGTCATAGTAAATCA
GTACTTGAAGTTGATATACAAGCTGTAAAAAGAGAATATAAAAATATTCAAGAAGAACTT
GAGAATATTAATAAGGAAAAAAGCGAATTGGAAACTGAGATTAATGAATATAAAAAAAGA
GAAAGGGAATATAAACAGAAAATCAACCTTGTGAATAATAATCTTAATTCACTTATAGAA
AGACTTAATGCTATGAAAGGAAGATTAGATACTTTAAATGCTAGATCTATTGATGATATG
CATGCTCAAGTTAAAAAACTTCAAACACTTTTAGGTAAAATAACTGAAAGTGTTAATAAA
ACTGAAATTATTATAAAGAAAAAAGATGCACTTATTACTGATATTGATGGGAGAATTGAA
GAAGCTGCTGGAAATGAGTTTAGGACTTTGAAAGCAGAGGTTAAAAGACTTTTAACTGAA
GAAGAAGCATCAGAAAAAGCGTTTTCTAAAGCTGAAGCAACACTTGTTCAAAGAAAAAAA
GATATTGAAACAAGGACAAAACAACTGGAAAAAGATGCGGCTGAGTTAGAGGAAAATAAA
AGACAATATGATAAAGTTAATAAAGAAAGAAATGAGTATACACAGAAAGCTCATGAAAAA
GTTGCAGAGATGGAAAATCTTACTGTTTTAGTACAAGAAAAAGAAAATAAAATAAATGAA
CTGGAGGCGCAAAAAATGGAAATTACTAAACAATTTGATGATATATTAAAATCTAGAGAT
TTAGTCAAGCAGAAAAAGAAGGAATTGGCTGGGGAGCTGAAGGCAGTATCAGATGAAATT
CAAAAATGGCAGATTAAACTGGAGCATACAATTGAGGATTATAAGAATATTGAAAGAGAT
TATTCCAATTTTCTACAAGGCATGGTCCTTGATCAGCAAAACCAATCAAATCTTGAACAT
CAAAGTAGGAAAAATCGTTTAGGTGAAGAAAGGAGTAATCTTATCCGTCCTGTAGACTGG
GATGCATCTGAAGCTGAGCTTAACGAACTAATCCCTAAAATCAAGATAATTGAAGATATA
GAAAAATACATCGAAGCTGAACTATCTTCCAATAGACCCAATCTAAATGTCATCCAAGAA
TACAAACAGAAATCCGATGATAAAAACCAAAAAGAAAACATCTTAAACGAAGCCAAGCAA
AAAGAAAACGACCTTAAAACCTTATACACTGATTTCAAAAACAAAAGGTTCAACGAATTC
ACAAAAGGTTTCAGAGAAATATCCGAAAAACTCAGAGAAATGTATACAAAACTAACCCGT
GGGGGAAATGCAGAGTTAGAATTCGCTGATTCTACTGACCCTTTCTCTGAAGGTATTGTA
TTCACTGTAAGGCCTCCATCAAAAAACTGGAAAAAAATGGCTAATCTTTCAGGAGGTGAA
AAAACTTTAAGTTCACTTGCCTTAGTATTTGCCCTTCATCATTACAAGCCTAATTCTTTA
TATGTAATGGATGAAGTAGATGCAGCTTTAGATTTCCAAAATGTTTCAGTAATAGCAAAT
TATATCAAAGGTGAGACTAAAAATGCTCAATTTATAGTCGTCTCCCTTCGATATCAAATG
TTTGAAGTTGCTGATCAACTTGTAGGTATCTACAAGACTAAAGATGTAAGTCACAGTTTA
TGTGTATCTCCTTATTCTCTTAAAGAAATGGGTAATGAAAACCCTATAGTAAGGCAAACA
TTAGAGAATATTTCAATGAAAGAGAATTAA