Identifiers and Description

Gene Model Identifier

SteCoe_10189

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005401002.6102790696677047e-23Rab V family protein; small mo
nomeric GTPase that regulates
membrane fusion and fission ev
ents
Oxytricha TrifallaxContig22470.0.g953.873997628687187e-21Ras family

WormBaseWBGene000042683.873997628687187e-21
Saccharomyces CerevisiaeYOR089C2.8625185805493937e-20Endosomal Rab family GTPase; r
equired for endocytic transpor
t and sorting of vacuolar hydr
olases; required for endosomal
localization of the CORVET co
mplex; required with YPT52 for
MVB biogenesis and sorting; i
nvolved in autophagy and ionic
stress tolerance; geranylgera
nylation required for membrane
association; protein abundanc
e increases in response to DNA
replication stress; mammalian
Rab5 homolog; VPS21 has a par
alog, YPT53, that arose from t
he whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10189(Protein)
MATMECKIVTLGEGRVGKTSLALKYVKNEFHKDEISTVNANYLTKLVQIPQGSVQLNIWD
TAGQERFRAIASNYYRQAKGALIVYDITDRKSFDKVVSWIKELKSQAEKNIVIVVAGNKC
DMEKERQINRPEALEFCRKMQIRHFDTSAKSGNGVEEMFMELASQIFEANKGELGQSGRN
SRRGKITVEKTKHRENSGKKGGCC


>SteCoe_10189(CDS)
ATGGCTACAATGGAGTGTAAAATCGTCACTCTTGGAGAAGGACGAGTAGGCAAGACTTCC
CTAGCACTAAAATACGTGAAAAACGAATTTCACAAAGACGAGATCTCAACAGTAAACGCG
AACTACCTAACAAAGCTTGTTCAAATTCCCCAAGGTTCAGTGCAGCTCAATATTTGGGAC
ACCGCTGGGCAGGAACGATTCAGAGCAATAGCCTCAAATTATTACCGACAAGCAAAAGGT
GCTTTAATAGTTTACGATATAACTGACAGGAAGAGTTTTGACAAAGTTGTGTCATGGATC
AAAGAACTTAAGTCCCAAGCAGAGAAAAATATTGTTATAGTTGTAGCTGGGAATAAATGT
GATATGGAAAAAGAAAGGCAGATTAATAGACCTGAAGCATTAGAGTTCTGTAGGAAAATG
CAAATCAGGCATTTTGACACAAGTGCCAAGTCTGGAAATGGGGTTGAAGAAATGTTCATG
GAACTGGCTTCACAGATTTTTGAAGCTAATAAAGGAGAACTTGGTCAAAGTGGAAGAAAT
TCGAGAAGAGGGAAAATTACAGTAGAGAAAACTAAACATCGTGAGAATAGTGGGAAAAAG
GGAGGATGCTGCTAG