Identifiers and Description

Gene Model Identifier

SteCoe_10424

Standard Name

None

Aliases

None

Description

ANAPC3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig534.1.g1328.985825944049381e-37Tetratricopeptide repeat

Tetrahymena ThermophilaTTHERM_006918801.3336148155022614e-34TPR Domain containing protein
Saccharomyces CerevisiaeYBL084C2.8625185805493937e-20Subunit of the Anaphase-Promot
ing Complex/Cyclosome (APC/C);
APC/C is a ubiquitin-protein
ligase required for degradatio
n of anaphase inhibitors, incl
uding mitotic cyclins, during
the metaphase/anaphase transit
ion
WormBaseWBGene000031320.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10424(Protein)
MTSNATFLAERLNSEPSASQITKELKLKLLSKCYIQENSPQKVVLLLRSNLSEDNVYMYA
LCCFQTSKLDEAERAILKFPVLSAETNFLLGQICEKQCRMPEAINFYSKALSLNRTLWVA
YEKLCKLGSFIDPRQAFVGNTSHNPLIGSNIGNWGIQNNKQKPDEISEMMITLGKPIQLL
SQYSIDEALTAFKNLPEPQRNSGWALCQIGRCYFEKYDFPNAVEYFAKAFQVEPQRIEDL
DFYSSSLWYEKKNSELCYVLHNCLKNFYYSPQTWVIAGNFFSLQKERETAIKCFTRAIQL
NPFYTYAYALCGHEYLANEDFEQARSHYESAHNIDPRQYTALWGLGSMYFKQEKFTQSLQ
CYKAARTINPNSSILLTYLGVNYKSLNNLSEAINCFESAIKLDKKNPLPRFQLGILLSQM
NRDSDALRYLEGLCQENSKESHLYIQIGKIYAKLGHPEKALKFYNDAQELNPKNQNEIKN
LIEQLHGNSSFPIIP


>SteCoe_10424(CDS)
ATGACAAGCAATGCAACTTTTTTAGCTGAAAGATTGAATTCCGAGCCATCAGCAAGTCAG
ATTACCAAAGAGCTCAAACTCAAGTTATTATCAAAATGTTATATACAAGAAAATTCTCCA
CAAAAAGTAGTCCTTCTGCTTAGATCTAATCTTTCTGAAGATAATGTTTATATGTATGCC
TTATGTTGTTTTCAGACTAGTAAATTAGATGAAGCTGAGCGGGCCATTTTGAAGTTCCCA
GTTCTTAGTGCAGAGACAAATTTTTTACTAGGGCAGATTTGTGAGAAACAATGTAGGATG
CCGGAAGCTATAAATTTTTATAGTAAAGCGCTAAGTTTGAATAGAACATTATGGGTAGCT
TATGAAAAACTCTGCAAACTTGGCAGTTTTATTGACCCGCGGCAAGCATTTGTTGGTAAT
ACTTCTCATAATCCACTTATTGGATCAAATATTGGTAATTGGGGTATACAGAATAATAAA
CAAAAACCTGATGAAATTAGTGAAATGATGATTACCCTTGGAAAACCTATACAGTTACTT
AGCCAATATAGTATTGATGAAGCATTGACTGCTTTTAAAAATTTACCTGAACCTCAGAGG
AATTCTGGATGGGCTTTGTGTCAGATTGGTAGATGTTATTTTGAGAAGTATGATTTTCCT
AATGCGGTAGAGTATTTTGCTAAAGCTTTTCAGGTTGAACCTCAGAGAATTGAAGATTTA
GATTTTTACTCAAGCTCGCTATGGTATGAGAAAAAGAACTCTGAACTTTGTTATGTGTTG
CATAATTGCTTGAAGAATTTTTATTATAGTCCGCAAACTTGGGTAATTGCGGGGAACTTT
TTTTCGCTGCAGAAAGAGAGGGAAACAGCAATCAAGTGTTTTACTAGGGCGATACAACTA
AATCCTTTTTATACTTATGCATATGCTCTTTGTGGACATGAGTATCTAGCAAACGAAGAT
TTTGAGCAAGCAAGATCTCACTATGAATCTGCTCATAATATTGACCCAAGACAATATACT
GCATTATGGGGTTTAGGTAGTATGTATTTCAAACAAGAAAAATTCACCCAAAGTCTCCAA
TGCTATAAAGCAGCAAGGACTATAAACCCAAATTCAAGCATACTTCTAACCTATCTTGGT
GTTAACTACAAATCCTTAAACAATCTTTCAGAAGCTATAAATTGTTTTGAATCTGCAATA
AAATTAGATAAAAAAAACCCTCTTCCACGTTTTCAATTAGGCATTCTTTTATCACAAATG
AATCGTGACTCTGATGCTTTAAGATACTTAGAAGGACTCTGTCAAGAAAACTCTAAAGAA
TCCCATCTTTATATACAAATAGGGAAAATATATGCTAAACTTGGACACCCAGAAAAAGCA
TTGAAGTTTTATAATGATGCTCAAGAACTTAACCCAAAAAACCAAAATGAGATTAAAAAC
CTTATAGAACAATTACATGGAAATTCATCTTTTCCAATTATACCTTAG