Identifiers and Description

Gene Model Identifier

SteCoe_10647

Standard Name

None

Aliases

None

Description

FA_hydroxylase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_011947202.2856936767186716e-49Catalyzes the introduction of
a C-5(6) double bond into lath
osterol and cholestanol (Nusbl
at, et al. 2009)

Saccharomyces CerevisiaeYLR056W0.000000000013887943864964021C-5 sterol desaturase; glycopr
otein that catalyzes the intro
duction of a C-5(6) double bon
d into episterol, a precursor
in ergosterol biosynthesis; mu
tants are viable, but cannot g
row on non-fermentable carbon
sources; substrate of the HRD
ubiquitin ligase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10647(Protein)
MVSIFLTNIGLYSINQEQRLTQQSLHPSHAGKILNFSSYISNPLLNEYLVIYFHTIIFGS
LLYLVLSTVSYIFFFKLNKEKYLPTLKTNRFKISHDIKWSLINIWIEAFLVSILRMVIPR
YSFIYFELSELPYWVIPISIICHLIWDETLTYWAHRFLHTYRWLYLKLHIVHHRSIDITP
YAGFAFHPIDAFLQALPTFTSCFIFPIHYDIFLAFSIVTTIWAVSIHDNVPAMPCKLFLY
ATHHTIHHEKGKGSFRNYGKFTSVWDRLMGTYEDPDRIYYGWTAGNRAKFFEKFNNALSY
YLNEKIAKAD


>SteCoe_10647(CDS)
ATGGTAAGCATCTTCTTGACTAATATTGGGTTATATTCAATAAACCAAGAGCAAAGACTA
ACTCAGCAGTCTCTCCATCCATCACATGCAGGAAAAATTTTGAATTTCTCTTCATATATC
TCAAATCCTTTACTAAATGAGTACCTGGTGATTTATTTCCACACAATAATCTTCGGTAGT
CTACTCTATTTAGTCTTATCAACAGTTAGCTACATCTTTTTCTTTAAGCTTAACAAGGAA
AAATACCTTCCGACACTTAAAACAAACAGATTCAAAATTTCTCACGACATAAAATGGTCT
CTTATCAATATATGGATAGAAGCTTTTCTTGTCTCTATACTTAGAATGGTTATCCCTAGA
TATTCTTTTATCTATTTTGAATTATCAGAATTACCTTATTGGGTTATCCCTATAAGTATA
ATTTGTCATTTGATTTGGGATGAAACTTTAACATATTGGGCTCATAGATTTTTACATACA
TACCGTTGGCTTTATTTAAAATTACATATAGTCCATCATCGTTCTATAGATATAACTCCA
TATGCAGGATTTGCATTTCACCCGATAGATGCATTTTTACAAGCATTACCAACATTTACA
AGCTGTTTTATTTTCCCGATACACTATGATATTTTCTTAGCATTTTCTATAGTAACAACT
ATATGGGCTGTTTCTATACATGATAATGTCCCAGCTATGCCATGTAAACTTTTTTTATAT
GCCACGCATCATACAATTCATCATGAAAAAGGTAAAGGGAGTTTTAGGAACTATGGGAAA
TTTACTTCAGTTTGGGATCGTCTGATGGGAACTTATGAAGACCCGGATAGGATTTATTAT
GGTTGGACTGCAGGGAATCGGGCAAAATTCTTTGAAAAGTTCAATAATGCCCTTAGTTAT
TACCTTAATGAAAAAATCGCTAAAGCTGATTAG