Identifiers and Description

Gene Model Identifier

SteCoe_10964

Standard Name

None

Aliases

None

Description

adh_short domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003174406.991989996645917e-56Fusion of peroxisomal multifun
ctional oxydation protein and
2-enoyl-CoA hydratase
Oxytricha TrifallaxContig22293.0.g191.0377033238158346e-53short chain dehydrogenase

Saccharomyces CerevisiaeYKR009C4.590938473882946e-483-hydroxyacyl-CoA dehydrogenas
e and enoyl-CoA hydratase; mul
tifunctional enzyme of the per
oxisomal fatty acid beta-oxida
tion pathway
WormBaseWBGene000009911.2479464629129513e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10964(Protein)
MALKLRFDNRVAIVTGAGGGLGRAYALELAKRGAKVVVNDLGVSRTGEGASSKAADLLVE
EIKSNGGVAIPNYDSVEQGHKIIEAAIKAFGRIDIIINNAGILRDVSVQKMTEKDWDMVI
AVHLKGAFILVKAAWKYMREQKYGRIINTSSSSGLYGNFGQANYSTAKLGLHGLTQTLAK
EGDKYNIKCNTIAPSAASRMTQDIFTPDLHELLVPEKVVPLVTYLAHENCNENGGLYEVA
GGYIGKLRWQRSQGVFYPGTFTAEDVKAKWNEAGNFDGNNDYPSALTDTLQKVMKFIEIS
KPKL


>SteCoe_10964(CDS)
ATGGCTTTAAAGCTTCGCTTTGACAATCGAGTGGCAATTGTCACTGGTGCTGGTGGGGGT
TTAGGCCGGGCATATGCTTTAGAATTAGCAAAACGCGGAGCAAAAGTTGTAGTAAATGAT
CTTGGAGTATCACGAACTGGAGAAGGAGCATCATCCAAAGCAGCTGATCTTCTAGTTGAA
GAAATCAAAAGTAATGGAGGAGTAGCTATTCCTAATTATGATAGTGTTGAACAAGGACAT
AAAATTATTGAAGCTGCTATTAAAGCTTTTGGGAGAATTGATATTATAATCAACAATGCT
GGGATATTAAGAGATGTCTCAGTACAAAAAATGACTGAAAAAGATTGGGATATGGTGATT
GCCGTGCATTTAAAAGGGGCTTTTATACTTGTTAAAGCTGCATGGAAATATATGCGTGAA
CAGAAATATGGGAGAATCATCAACACTTCAAGTAGTTCAGGTTTATATGGTAACTTTGGA
CAAGCAAATTATTCTACAGCCAAACTTGGACTTCATGGTTTAACTCAAACATTAGCTAAA
GAAGGAGATAAATATAATATTAAATGCAATACAATTGCCCCTTCAGCTGCATCAAGAATG
ACTCAAGATATTTTTACTCCAGATCTTCATGAACTTCTTGTTCCAGAAAAAGTTGTCCCA
TTAGTCACTTATTTGGCTCATGAAAATTGTAATGAAAATGGAGGACTTTATGAAGTTGCA
GGTGGGTATATTGGGAAATTAAGATGGCAAAGAAGTCAAGGAGTGTTTTATCCTGGGACT
TTTACTGCTGAAGATGTTAAAGCTAAATGGAATGAAGCAGGTAATTTTGATGGAAATAAT
GACTACCCAAGCGCACTTACTGACACTTTGCAAAAAGTTATGAAGTTTATTGAAATATCA
AAACCTAAACTTTAG