Identifiers and Description

Gene Model Identifier

SteCoe_10971

Standard Name

None

Aliases

None

Description

Proteasome_A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511
  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYGR253C3.720075976020836e-44Alpha 5 subunit of the 20S pro
teasome; involved in ubiquitin
-dependent catabolism; human h
omolog is subunit zeta
Oxytricha TrifallaxContig622.0.g527.47197233734299e-43Proteasome subunit

WormBaseWBGene000039264.4737793061811207e-38
Tetrahymena ThermophilaTTHERM_000438803.6251409191435593e-3420S proteasome core alpha subu
nit 5

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10971(Protein)
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTALGITCKEGVVIAVERRVTSPLIE
PSSIEKLFEIDSHIGCAMSGILADARTLVDHARSEAQSHRFIFSEPIKAQSVAQSVCDMA
LNFGEGDGSQKKPMARPYGVALLIAGVDRSGAALFNTDPSGTLFRYKAKAIGSAAEGAQT
MLEEEWNENLSLDDAVRLAAKILKQVMEEAITPVNVEIAVVPVSSQKYQSLPTEQVAEIL
RSLS


>SteCoe_10971(CDS)
ATGTTCTTGACCCGCAGCGAATACGACAGAGGAGTGAACACTTTTTCTCCAGAAGGTCGG
CTTTTTCAAGTAGAATACGCAATCGAAGCTATAAAACTAGGGTCAACTGCCCTTGGCATA
ACTTGTAAAGAAGGTGTTGTTATAGCCGTAGAACGTAGGGTCACAAGTCCTTTAATCGAG
CCTTCTTCAATAGAAAAGCTCTTTGAAATCGACTCTCATATAGGTTGTGCAATGTCAGGA
ATCTTAGCCGATGCTCGTACTTTAGTAGATCATGCACGTTCTGAAGCTCAATCACATAGA
TTTATATTCAGCGAACCAATCAAAGCACAAAGTGTAGCCCAAAGCGTCTGTGACATGGCT
TTAAATTTCGGTGAAGGGGATGGGTCACAAAAAAAACCTATGGCCAGACCTTATGGTGTA
GCTTTATTAATAGCAGGAGTAGATCGTAGTGGTGCAGCTTTATTCAACACTGATCCTTCA
GGGACATTATTTAGATATAAAGCTAAAGCTATTGGAAGCGCTGCTGAAGGAGCTCAAACT
ATGCTTGAAGAAGAATGGAATGAAAATTTGTCTTTAGATGATGCTGTTAGACTTGCAGCG
AAAATTTTAAAGCAGGTTATGGAAGAAGCTATTACCCCAGTCAATGTAGAAATTGCTGTA
GTACCAGTGAGTAGTCAGAAGTATCAGTCATTGCCTACAGAACAAGTAGCAGAAATACTT
AGATCGCTTAGTTAA