Identifiers and Description

Gene Model Identifier

SteCoe_10997

Standard Name

None

Aliases

None

Description

MutS_II domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000018727.095474162284704e-23
Tetrahymena ThermophilaTTHERM_008578901.4251640827409352e-21Meiotic pro-crossover factor
M
utS domain II family protein
Saccharomyces CerevisiaeYFL003C1.4251640827409352e-21Protein involved in meiotic re
combination; required for norm
al levels of crossing over, co
localizes with Zip2p to discre
te foci on meiotic chromosomes
, has homology to bacterial Mu
tS protein
Oxytricha TrifallaxContig22029.0.g674.248354255291589e-18MutS domain V

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10997(Protein)
MLITPRGSQPSKRTPSTSKDKTCMMSIIENRSREVGIAYININSFEIFITQYVDNIDYFH
TLSLIYNCDPVEILMCKTAEESLLTHRIHSHLNYYDISFLSRKLFDEIKGEQLCLGSLIR
PLDQDIQSKYVCLAALSALISHIELIQNANVYKDRLKINLIYLKNFLIIDCYTIKALEIM
TSAEGVKKDALVGLFDCKTQAGSRILRASLLQPNKEPKIVNTRLSAVEELINNSVARVEI
KNCLGAFVNTELATSKILQQPKQLSEKYMRSQITNILNIFHNLEQCKNLYNILIKTSLCS
KGFKELIELLDDRQIDSLYDDIINVLSDTVVEKKIKKVTIFDCLFLVKEGRNVLLDISRQ
AYNKYIEEIHKLECQYRCRLSDSNISIIYTPVRGYHLQLDSSVLHRNYYSLLGEHLLKIT
HKEKKCFATTYSLLHLNEKIKSSQTEIINRTYSVIEELCAKARDKIICLYNISQAVATLD
LYLAFSVFSITYECSKPIFKEGKIKIVEGKNPLLICKKDIKSNDYKFSRSCCLQVLTGAN
SSGKTTYLKTLALLSILSHSGCFVPVKKFVISPLSYILTRIGDKESIELNSSSFVAEMYD
CRYILNTCNSESLVLLDELGKSTSTQDGIALAWAICEKLFKTHAFTLVATHFHQLSLLES
LNPCIINIHIENYVVSLGPASRTSGYGIELALQSALPQNISIRAQKFLHDFEEIMSRCQK
QALDCKEKKKMKLVEELVKLKKAKISKDQIKLYLLKLKEEFC


>SteCoe_10997(CDS)
ATGCTTATCACACCTCGTGGTAGTCAACCCTCCAAACGTACTCCTTCAACCTCTAAAGAC
AAAACTTGTATGATGTCAATAATAGAAAACCGTTCAAGAGAAGTAGGTATAGCTTATATC
AACATAAATTCTTTTGAAATTTTTATAACCCAATACGTTGACAATATAGACTACTTTCAT
ACCTTATCATTAATCTACAATTGTGACCCAGTAGAAATCCTCATGTGTAAAACCGCAGAA
GAAAGTTTATTAACACATCGTATCCATTCTCATCTAAACTATTATGACATATCATTTTTA
TCTAGAAAACTATTTGATGAAATCAAAGGTGAGCAACTCTGCTTAGGATCTTTAATTAGA
CCATTAGACCAAGATATCCAAAGCAAATACGTCTGCCTTGCAGCACTTTCAGCATTAATT
TCCCATATTGAGCTAATCCAAAATGCTAATGTTTATAAAGATCGTCTAAAAATCAATTTG
ATATACTTAAAAAACTTTCTCATCATAGATTGTTATACTATAAAAGCTTTAGAAATCATG
ACAAGTGCTGAAGGGGTGAAAAAAGATGCCCTTGTAGGATTGTTTGATTGTAAAACTCAA
GCTGGAAGCCGAATACTCAGAGCTTCATTACTCCAACCAAACAAAGAGCCTAAAATTGTT
AATACAAGATTATCAGCAGTTGAAGAACTTATAAATAATAGTGTTGCAAGAGTTGAAATA
AAAAATTGTTTAGGAGCTTTTGTCAATACCGAACTTGCTACATCAAAAATCCTCCAACAA
CCAAAACAATTATCTGAAAAGTATATGAGAAGCCAGATAACAAATATTTTAAACATATTT
CACAATTTGGAACAATGTAAGAATTTATATAACATTCTTATAAAAACTAGTCTTTGTAGT
AAAGGGTTTAAAGAACTTATTGAGTTACTTGATGATAGGCAAATTGATTCTTTGTATGAT
GATATAATAAATGTGTTATCTGATACCGTTGTTGAAAAAAAAATCAAAAAAGTGACGATT
TTTGACTGTTTGTTTTTGGTTAAAGAGGGGAGAAATGTTTTATTGGATATTTCTAGACAG
GCTTATAATAAATATATTGAAGAAATACATAAGCTTGAATGCCAATATAGATGTAGGCTT
TCTGATTCAAATATTAGTATTATATATACTCCAGTTCGTGGGTATCATTTACAATTAGAT
TCAAGTGTTTTACATAGGAATTATTATTCGCTTCTTGGGGAACATTTATTAAAAATAACT
CATAAAGAAAAAAAATGTTTTGCGACAACATATTCATTACTTCATCTTAATGAAAAAATT
AAATCCTCACAAACTGAGATTATTAATAGAACTTATTCGGTTATTGAAGAATTATGTGCG
AAAGCTAGAGATAAGATTATTTGTCTTTATAATATATCACAAGCTGTAGCTACTTTAGAC
TTATATCTAGCTTTTAGTGTGTTTTCTATAACTTATGAATGTAGTAAACCTATTTTTAAA
GAAGGGAAAATCAAAATTGTAGAAGGAAAAAATCCTTTGCTTATATGCAAAAAAGATATA
AAAAGCAATGATTATAAATTTTCTAGATCGTGTTGTTTGCAAGTCCTTACTGGGGCGAAT
TCTTCAGGTAAAACAACTTATTTGAAAACTTTAGCACTTTTATCAATATTATCACATAGT
GGATGTTTTGTTCCTGTTAAAAAATTTGTAATTAGTCCTTTAAGTTATATACTTACCAGA
ATTGGAGATAAAGAGTCAATTGAACTTAATTCATCGAGTTTTGTTGCTGAAATGTATGAT
TGTAGGTATATATTAAATACTTGTAATTCTGAAAGCCTTGTTTTACTTGATGAACTTGGG
AAAAGTACATCAACTCAAGATGGTATTGCTTTAGCTTGGGCAATATGTGAGAAATTATTC
AAGACTCATGCCTTTACATTAGTCGCTACTCATTTTCATCAACTCTCTTTGCTTGAGTCG
CTAAATCCTTGTATTATAAATATTCATATAGAAAATTATGTTGTGTCGCTTGGACCAGCT
AGCCGAACTTCTGGTTATGGAATTGAATTAGCTTTGCAAAGCGCTTTACCACAAAATATA
TCAATTAGAGCTCAGAAGTTTTTGCATGATTTTGAAGAGATTATGAGTAGGTGTCAAAAA
CAAGCTTTGGATTGTAAGGAGAAAAAAAAAATGAAGCTGGTTGAAGAGTTGGTCAAGTTG
AAAAAAGCTAAAATCTCAAAAGATCAGATAAAGCTATATTTGTTAAAACTGAAAGAAGAG
TTTTGTTAG