Identifiers and Description

Gene Model Identifier

SteCoe_10999

Standard Name

None

Aliases

None

Description

ATP-synt_ab_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19301.0.g140ATP synthase alpha/beta family
, nucleotide-binding domain

WormBaseWBGene000130250
Saccharomyces CerevisiaeYDL185W1.4043787324419038e-54Subunit A of the V1 peripheral
membrane domain of V-ATPase;
protein precursor undergoes se
lf-catalyzed splicing to yield
the extein Tfp1p and the inte
in Vde (PI-SceI), which is a s
ite-specific endonuclease; the
V1 peripheral membrane domain
of the vacuolar H+-ATPase (V-
ATPase) has eight subunits; in
volved in methionine restricti
on extension of chronological
lifespan in an autophagy-depen
dent manner

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_10999(Protein)
MAEKKYGTIYKVAGPLVVANNMAGSKMYELVRVGWNRLVGEIIKLEADNASIQCYEDTSG
LTVGDPVLRTGNLLSVSLGPGIMETIYDGIQRPLKRIAEESGGSVFVPKGIDVYPLDMNK
QWEFIPKNVRVGQMISGGDIFGLVHENDLFENHWIMMPPKAQGRITWLAPDGMYTVGEEV
IEVEFNGEKKRYPMYHDWPVRIPRPYVEKLPGKTPLLTGQRVLDALFPSCLGGTCAIPGA
FGCGKTCISQALSKFSNSDCIIYVGCGERGNEMAEVLTEFPELTRKYKGGEASIMQRTCL
VANTSNMPVAAREASIYTGITLAEYFRDQGLHVSMMADSTSRWAEALREISGRLAEMPAV
AGYPAYLGSKLAQFYERAGRVTCFGSPNREGSVSIVGAVSPPGGDLTDPVTTSTLNIVQV
FWGLDKKLAQRKHFPSVNWSISFSNYERQVEPYFDLQDPEFSTLRTKFKEILTEEEDLNE
IVQLVGVESLSEDQKLTLEVAKMIKEDFLQQNAFSKNDYMCPFFKIVGMMRAIVTFYEQA
VKVIRESPATNKVGCKNIMQELSRQVYDISQMKGAIYPDAGDDAFKKFFSDLCDRITSQF
RKIEDSYA


>SteCoe_10999(CDS)
ATGGCTGAGAAGAAATACGGAACTATATACAAAGTAGCAGGGCCTCTGGTTGTCGCAAAC
AACATGGCTGGATCTAAGATGTATGAACTGGTTCGTGTAGGTTGGAACCGTCTAGTGGGA
GAAATCATCAAACTAGAAGCAGACAATGCAAGTATTCAATGCTATGAGGACACATCAGGT
CTAACTGTAGGAGATCCAGTCCTTCGTACCGGTAACCTCTTATCCGTATCTTTAGGTCCA
GGAATCATGGAAACAATCTATGACGGTATTCAAAGACCATTAAAAAGAATCGCAGAAGAA
AGTGGTGGCTCAGTCTTTGTGCCAAAAGGTATCGATGTTTATCCACTTGATATGAATAAA
CAATGGGAATTTATACCTAAAAATGTTAGAGTTGGGCAGATGATATCAGGTGGTGACATT
TTTGGTTTAGTTCATGAAAATGACTTGTTTGAAAACCATTGGATTATGATGCCACCAAAA
GCTCAAGGAAGGATTACTTGGTTAGCCCCTGATGGGATGTATACTGTAGGTGAAGAGGTT
ATAGAAGTTGAATTTAATGGTGAAAAGAAAAGATACCCGATGTATCATGATTGGCCTGTG
AGAATTCCAAGACCTTATGTTGAAAAGCTTCCAGGTAAAACCCCATTATTAACAGGGCAA
AGAGTTCTTGATGCACTTTTCCCATCTTGTCTTGGAGGGACATGTGCAATTCCAGGAGCT
TTCGGTTGTGGTAAGACTTGTATTTCTCAAGCGCTTTCTAAGTTTTCGAACTCAGACTGC
ATTATTTATGTTGGGTGTGGTGAAAGAGGTAACGAAATGGCTGAGGTTTTAACTGAGTTC
CCTGAGCTTACAAGGAAATATAAAGGTGGTGAGGCTAGTATTATGCAAAGAACCTGTTTG
GTTGCCAATACTTCAAATATGCCTGTGGCTGCAAGAGAAGCTTCAATTTATACAGGGATT
ACATTGGCTGAATACTTTAGAGATCAAGGACTTCATGTAAGTATGATGGCTGATTCAACA
TCAAGATGGGCTGAAGCTTTAAGAGAAATCTCAGGTCGTCTAGCTGAAATGCCTGCTGTT
GCTGGTTACCCTGCTTATTTAGGGTCTAAATTAGCTCAGTTTTATGAAAGAGCAGGAAGA
GTCACTTGTTTTGGAAGCCCTAATCGTGAAGGCTCAGTTAGTATTGTTGGAGCTGTTAGT
CCTCCAGGTGGTGATTTGACTGATCCAGTCACAACTTCAACTTTGAATATAGTCCAAGTC
TTTTGGGGACTTGATAAGAAACTTGCCCAAAGAAAACATTTCCCTAGTGTCAATTGGAGT
ATATCCTTCAGTAATTATGAAAGACAAGTTGAGCCTTATTTTGACTTACAAGACCCTGAG
TTCTCTACTTTAAGGACAAAATTCAAAGAAATCTTAACTGAAGAAGAAGATCTTAATGAA
ATCGTCCAGCTTGTTGGTGTTGAAAGTTTATCTGAAGACCAGAAACTTACTTTAGAAGTC
GCTAAGATGATTAAAGAAGATTTCCTTCAACAAAATGCTTTTTCTAAAAATGATTATATG
TGTCCATTTTTCAAGATTGTTGGGATGATGAGAGCTATAGTCACTTTTTATGAACAGGCA
GTAAAGGTTATTAGAGAATCACCTGCTACTAATAAAGTTGGATGCAAAAATATAATGCAA
GAATTATCAAGACAGGTTTATGATATTTCACAAATGAAAGGTGCAATATACCCTGATGCT
GGGGATGATGCATTTAAGAAATTCTTCTCTGATCTTTGTGATAGGATAACTTCGCAGTTT
AGGAAGATTGAAGACTCTTATGCATAG