Identifiers and Description

Gene Model Identifier

SteCoe_11063

Standard Name

None

Aliases

None

Description

TRM domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10417.0.g416.054601895401186e-39N2,N2-dimethylguanosine tRNA m
ethyltransferase

Tetrahymena ThermophilaTTHERM_006368603.6251409191435593e-34N2,N2-dimethylguanosine tRNA m
ethyltransferase family protei
n
WormBaseWBGene000066133.975449735908647e-31
Saccharomyces CerevisiaeYDR120C1.0806392777072785e-30tRNA methyltransferase; two fo
rms of protein are made by alt
ernative translation starts; l
ocalizes to both nucleus and m
itochondrion to produce modifi
ed base N2,N2-dimethylguanosin
e in tRNAs in both compartment
s; nuclear Trm1p is evenly dis
tributed around inner membrane
in WT, but mislocalizes as pu
ncta near ER-nucleus junctions
in spindle pole body (SPB) mu
tants; both Trm1p inner nuclea
r membrane targeting and maint
enance depend upon SPB

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11063(Protein)
MVSHIEGAAQILLKGGVFMNPAQVFNRDMSMLVASAYAQSLENRPLHILEPLAATGLRSI
RYFKELNHPVERIVANDIDPSAVEQIKENFASNSVTGEVWQKDACDAMYTSRGLWDIVDI
DPYGSAAGFLDAAVRAVKSGGLLCVTSTDMITLCGNNPDTCFYKYQSIPSKSKYCHEFAL
RILLYQLNATANKYQFAIQPLISLSVDFYVRVFVKVISSAQTAKKSIGSSSLVFQCSECP
AYFIQGFGREHKGKDRWVGNVLTVDSNCPYCAKSKDHEVEDAKDEEGRGGQILMQGPIYT
GPLHDKEFVEKVLVLANLREFKTKDKVRGVLYSIREELETPLGINIGNLCKFFKVPAMSQ
KNLRSAMKSIGKDLSQSHTNPLIYKTTASFDDIYDIFRYWKKLKAPQRYLTNILKDSPAY
RVLTKEPKGPAPDFDQDLTEHEKSILGQIRYPINEPNWGPKPRPKKEEE


>SteCoe_11063(CDS)
ATGGTCTCACATATTGAAGGTGCAGCACAAATCTTACTTAAAGGTGGGGTGTTTATGAAT
CCAGCCCAAGTATTTAACCGAGACATGTCAATGCTTGTAGCTTCAGCTTATGCCCAAAGC
CTTGAAAATCGTCCTCTTCATATTCTTGAGCCATTAGCTGCAACAGGTCTTAGGTCAATT
CGTTACTTTAAAGAATTAAATCATCCAGTAGAACGTATTGTAGCTAATGATATAGACCCA
AGCGCAGTTGAACAAATCAAAGAGAATTTCGCATCAAACTCAGTAACTGGAGAAGTGTGG
CAAAAAGATGCTTGTGATGCCATGTATACTTCAAGAGGACTCTGGGATATAGTCGATATT
GACCCTTATGGTTCAGCTGCTGGGTTTCTTGATGCTGCTGTACGAGCTGTAAAATCTGGA
GGCCTTCTTTGTGTAACAAGTACCGATATGATTACTTTATGTGGTAATAATCCTGATACA
TGTTTTTATAAATATCAAAGTATACCAAGTAAATCAAAATATTGTCATGAATTTGCATTA
AGAATTTTATTATATCAACTCAATGCTACAGCTAATAAATACCAATTCGCTATTCAACCT
TTAATAAGCTTGTCAGTTGATTTTTATGTTCGAGTTTTTGTCAAAGTTATAAGTTCAGCA
CAAACAGCTAAAAAATCTATTGGATCATCATCTTTAGTTTTCCAATGCTCTGAATGCCCA
GCGTATTTTATACAAGGATTTGGTAGGGAACATAAAGGTAAAGATAGATGGGTTGGTAAT
GTTTTGACTGTAGATTCAAATTGCCCTTATTGTGCAAAGAGTAAAGATCATGAGGTTGAG
GATGCTAAGGATGAGGAAGGTAGAGGAGGACAAATACTTATGCAGGGACCAATTTATACT
GGGCCTTTACATGATAAAGAGTTTGTAGAAAAGGTGTTGGTATTAGCAAATCTGAGGGAG
TTTAAGACTAAAGATAAAGTTAGAGGGGTACTTTATAGTATAAGAGAAGAACTTGAGACT
CCATTAGGGATTAATATAGGAAACTTATGCAAGTTTTTCAAAGTCCCAGCTATGTCGCAA
AAGAACCTTAGAAGTGCGATGAAAAGCATTGGGAAAGATTTATCACAATCTCATACTAAT
CCACTTATATACAAAACCACAGCTAGTTTTGATGACATTTATGATATTTTCAGGTACTGG
AAGAAACTTAAAGCTCCACAAAGGTATCTGACAAATATCCTAAAAGACTCCCCAGCTTAT
AGAGTATTAACAAAAGAGCCAAAGGGACCAGCTCCTGATTTTGACCAAGATTTGACAGAA
CATGAGAAAAGCATATTAGGACAAATAAGGTATCCTATAAACGAGCCGAATTGGGGACCA
AAACCTAGACCTAAAAAAGAAGAGGAATAA