Identifiers and Description

Gene Model Identifier

SteCoe_11068

Standard Name

None

Aliases

None

Description

TBP domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYER148W1.1089390193121365e-40TATA-binding protein; general
transcription factor that inte
racts with other factors to fo
rm the preinitiation complex a
t promoters, essential for via
bility
WormBaseWBGene000065421.6458114310822737e-38
Tetrahymena ThermophilaTTHERM_005753508.985825944049381e-37TATA-binding protein; componen
t of the basal transcription a
pparatus; found in macronuclei
throughout life cycle, but on
ly found in micronuclei early
in conjugation
Oxytricha TrifallaxContig9118.0.g561.3336148155022614e-34Transcription factor TFIID (or
TATA-binding protein, TBP)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11068(Protein)
MAEFRELNAISSSVLDKDNSIALQFTNFEDQPLNNNDRPNLQNVVATANMMCQLDLKTIA
LKARNAEYNPKRFAAVIMRIREPKTTALIFTSGKMVVTGAKDESQARNAARKFTRIIQKI
NYPEARFSEFKIQNLVASVDVKFPIRLEGLAQEHYQFSSYEPEVFPGLIYRMLNPKVALL
IFVSGKLVLTGARHREDIDKAFDKIYPVLKKFEKKNK


>SteCoe_11068(CDS)
ATGGCCGAGTTCCGTGAACTTAATGCGATAAGCTCGAGTGTTCTTGACAAGGATAACTCA
ATAGCTTTGCAGTTTACAAATTTCGAAGATCAGCCCTTAAACAATAACGACAGGCCTAAT
CTTCAAAATGTTGTGGCAACGGCAAATATGATGTGTCAATTGGATCTTAAGACAATCGCC
TTAAAAGCAAGAAATGCTGAATACAATCCAAAGCGTTTTGCCGCTGTTATTATGAGGATT
CGTGAACCGAAAACAACAGCCTTGATTTTCACTAGTGGGAAAATGGTTGTGACTGGTGCG
AAAGATGAAAGTCAAGCAAGAAATGCTGCGAGAAAATTCACGAGAATCATCCAAAAAATC
AACTACCCTGAAGCTAGGTTTTCTGAGTTCAAAATCCAGAACTTAGTCGCCTCTGTTGAT
GTTAAGTTTCCTATACGTCTTGAAGGTTTAGCACAGGAACATTATCAGTTCTCTAGTTAT
GAGCCAGAAGTTTTCCCAGGGCTTATTTATAGGATGTTGAATCCTAAAGTCGCTTTATTG
ATATTTGTATCAGGAAAACTTGTCCTTACAGGAGCGAGGCATAGAGAAGATATTGATAAA
GCTTTTGACAAAATCTATCCTGTACTGAAAAAATTCGAAAAGAAAAATAAATAA