Identifiers and Description

Gene Model Identifier

SteCoe_11117

Standard Name

None

Aliases

None

Description

TPR_8 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18954.0.g90TPR repeat

Tetrahymena ThermophilaTTHERM_004859401.7785284761271306e-68TPR Domain containing protein
WormBaseWBGene000038580.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11117(Protein)
MLSSTTSVPSRPVFSHEIDTMITICNKKLKVNPDDTKVLLLRASNYIKKGLFDQAIFDCN
KVLEIDPENPGGFYILGNCYEKIGDFDTSIVNYTRTLQIDPEHINAAYARAACQNRKGNF
AQAIEDYSIALEKDKETKYLSIKKLVKTKNQGCIAVRPTTPINFQDRSISPMASRRVLMP
NESNFTQSSMETVYKTESPDVEALHTQGYTARQRGDFSSAIDFYNEALKINPNHFKSLFN
RAFAFDKLNNYDLAISSYTQAIEIDSNNAYVYYNRGISYDKNEQLHPAIEDFTKAIRLEP
NKADFYHNRGFAYRKLKEYEKAIKDYTSALKIDSKHFKALYNRAFCWDKLNKIKEAERDY
TEALRIQPNNVNALHHLATLKEKEGELEKALEYFTKVLEIEPEYTPSYNGRGLVYDKQGK
FIEAIQDLTICIRLDKENPVYWHNRACCLRNSGQYQQALSDFNKALALDSSNGVIYANRA
LAWRKIEKFDKAIEDYTEEINQNGYSVKSLNNRAYCYAKLCLFDKAIEDYSKVLDKDVNN
LHALHNRGISYERNRQYEEAIKDFTLVIELDSGNANAYFNRGCCFDATGHLDKAITDYSK
ALELDMCNKDSN


>SteCoe_11117(CDS)
ATGTTATCATCAACCACTTCAGTACCATCACGACCAGTTTTTTCACATGAAATCGACACA
ATGATAACAATCTGTAACAAAAAGCTCAAAGTCAACCCAGACGACACAAAAGTGCTTCTT
TTGCGGGCTTCAAATTACATCAAAAAAGGTTTATTTGATCAAGCAATCTTCGACTGTAAC
AAAGTTCTAGAAATAGACCCAGAAAACCCAGGTGGATTCTACATACTTGGTAACTGTTAT
GAAAAAATCGGAGATTTTGATACAAGCATAGTCAATTACACAAGAACTTTACAGATTGAT
CCAGAGCATATAAACGCTGCATATGCTAGAGCAGCATGTCAGAACAGAAAAGGTAACTTT
GCCCAGGCAATAGAAGACTATTCAATAGCTTTAGAGAAAGATAAAGAGACTAAGTATTTA
TCGATAAAAAAATTAGTCAAAACAAAAAATCAAGGATGTATAGCTGTAAGGCCAACAACA
CCTATAAATTTCCAAGATAGGAGCATATCCCCAATGGCTTCAAGACGTGTGCTTATGCCC
AATGAATCAAATTTCACTCAATCATCCATGGAGACTGTTTATAAAACTGAATCTCCTGAT
GTTGAAGCTTTACATACCCAGGGGTATACCGCAAGACAGCGTGGGGATTTCTCTTCAGCT
ATTGACTTCTATAACGAGGCTCTAAAAATCAACCCAAACCACTTTAAATCCTTATTCAAC
CGAGCTTTTGCCTTTGATAAACTTAACAATTATGACTTAGCCATCTCCAGTTATACCCAA
GCTATAGAAATTGACTCCAATAATGCTTATGTATACTATAATCGAGGTATATCCTATGAT
AAAAATGAACAACTTCATCCAGCAATTGAAGACTTTACTAAAGCTATTCGACTCGAACCA
AACAAAGCTGATTTCTATCACAATCGAGGTTTCGCATATCGTAAGCTAAAAGAATATGAA
AAAGCTATAAAAGATTATACAAGCGCATTAAAAATTGATAGTAAACATTTCAAAGCTTTA
TACAATCGAGCATTTTGTTGGGATAAACTAAATAAAATCAAAGAAGCTGAACGAGATTAT
ACAGAAGCTTTACGTATACAACCAAATAATGTTAATGCATTACATCATTTAGCAACCTTA
AAAGAAAAAGAAGGTGAACTAGAAAAAGCTCTTGAGTATTTCACAAAAGTTTTAGAAATC
GAGCCTGAATATACTCCATCATATAATGGTAGAGGGTTAGTATATGATAAACAAGGGAAG
TTTATTGAAGCTATACAAGATTTAACGATATGTATTCGTTTAGATAAAGAAAACCCTGTT
TATTGGCATAATCGTGCTTGTTGTTTAAGGAATTCAGGACAGTATCAGCAAGCTTTAAGT
GATTTTAATAAAGCTTTAGCTTTAGATTCGTCAAATGGGGTTATTTATGCGAATCGAGCA
CTAGCTTGGAGGAAAATAGAAAAATTTGATAAAGCGATTGAAGATTATACTGAAGAAATC
AATCAGAATGGGTATTCGGTGAAATCTTTAAATAATCGGGCTTATTGTTATGCGAAATTA
TGCCTTTTTGATAAGGCGATTGAAGATTATTCGAAAGTATTGGATAAGGACGTGAATAAT
TTGCATGCGCTACATAATAGGGGGATTAGTTATGAGAGGAATAGGCAGTATGAGGAAGCG
ATAAAAGATTTTACGTTGGTGATTGAGTTGGATTCGGGGAATGCTAATGCGTATTTTAAT
AGAGGGTGCTGCTTTGATGCTACTGGGCATTTAGATAAAGCGATTACTGATTATTCGAAG
GCTTTAGAACTGGATATGTGTAATAAAGATAGTAATTAA