Identifiers and Description

Gene Model Identifier

SteCoe_11196

Standard Name

None

Aliases

None

Description

Chitin_synth_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19394.0.g621.3336148155022614e-34Chitin synthase

Saccharomyces CerevisiaeYNL192W1.462486227251231e-31Chitin synthase I; requires ac
tivation from zymogenic form i
n order to catalyze the transf
er of N-acetylglucosamine (Glc
NAc) to chitin; required for r
epairing the chitin septum dur
ing cytokinesis; transcription
activated by mating factor
Tetrahymena ThermophilaTTHERM_005999401.7587922024243116e-25Chitin synthase family protein
WormBaseWBGene000004960.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11196(Protein)
MAHGRSMSSQFVTSLVYQPVELLTEYEVEQINGITYNKLAKVEGITPLFPETKFKPSVLS
DLMKTDGELEFLIVVTMYNEDKNNFKDTMHGIVQNLKVFESDGLDPNLIACIIIVDGIKP
FMQTYKKDDQKIFFSNFFNEQMIKDRFSTDDVINGIKLEENQEIAHCFMTSTNFGLEGCP
DLNIVFAVKQLNKRKLNTHLWFFGGFCEMIQPKFIMLLDVGTKPLEASLCALYDVLKTNA
NIAGVCGEIAPMDPEYSNIVVSAQTVEYTFSHIFDKAMESCLGYIGVLPGAFSAYRWEAL
AAGPLMNDYFKSMTSPELMNAYNSNIFLAEDRVLSLALVSLPGHQYLLRFVPSAIAETDV
PAKLFQLLAQRRRWINGSWFALIDTWRTFSRIKNSDHTRWRKIWFSFQLVYFGVTILFTW
VMVGSFYLFTELIFAAIFKGFDQSAGGIMTLTEFLLSVYIAMILLVFMMSLGVKTGRVEG
TYRFISFGFSFYMLFTFFCTMYYTFTSNLTVYSWFLVAATIGSYSIGLLITGNTKKVALR
TVQFLMMTPIYVNVFQIYAICNIHDCTWGNRPDNLTEEEKAKREDFEHYRTKWVIIWIVS
NLVYVKIFETFIQIDSELIALYVLYTMAMILILIRFCGCIAFYFSNWFQNKGSKRYIRLG
SVVEANKEDKRILTEIVQKVNRGRAMSQKEIRNSIIGVIEKKAGNNERRQTQFQKDILKM
CRKSELLEDDVEEEGYSESIEENSNESDEDCSEYYNANSGKTKKIKKQTKKTKKTNGKSV
KKSVRESVRKSVRESKREKKDESKFSPIQSKVDAKIDAKNAEGMINFEDTIQKDPLWEND
EEGEESKNQESEVNKYLDMLSLIISNISDSN


>SteCoe_11196(CDS)
ATGGCACATGGAAGATCAATGTCATCTCAATTCGTCACATCTCTGGTTTATCAACCAGTA
GAGCTATTAACTGAATACGAAGTTGAACAAATCAATGGTATAACATACAATAAACTTGCT
AAAGTTGAAGGAATCACCCCATTATTTCCTGAAACAAAATTCAAACCATCAGTCCTCAGT
GATTTAATGAAAACAGATGGTGAGTTAGAATTCCTCATAGTCGTGACCATGTACAATGAA
GATAAAAACAACTTCAAAGATACAATGCATGGCATAGTCCAAAACCTAAAAGTCTTTGAA
TCTGATGGTTTAGATCCCAACCTAATTGCATGTATAATAATCGTTGATGGTATCAAACCT
TTTATGCAAACATACAAAAAAGATGACCAGAAAATTTTCTTTTCAAATTTCTTCAATGAG
CAAATGATAAAAGACCGTTTTTCTACAGATGATGTTATAAATGGTATCAAATTAGAAGAA
AATCAAGAAATAGCCCATTGTTTTATGACATCAACTAACTTTGGCCTTGAAGGATGTCCT
GATTTAAACATTGTATTTGCTGTAAAACAATTGAATAAACGTAAACTCAATACACATTTA
TGGTTTTTTGGAGGTTTTTGTGAGATGATTCAGCCTAAATTTATTATGTTATTAGATGTT
GGAACTAAGCCATTAGAAGCTTCTTTATGTGCTTTGTATGATGTTCTTAAAACTAATGCT
AATATAGCAGGTGTTTGTGGTGAAATCGCCCCTATGGACCCTGAGTATTCTAATATTGTT
GTATCAGCTCAAACTGTTGAATATACTTTTTCACATATTTTTGATAAAGCTATGGAAAGC
TGTTTAGGGTATATCGGGGTCTTACCTGGAGCTTTTAGCGCTTATAGATGGGAAGCATTA
GCTGCAGGGCCTTTAATGAATGATTACTTTAAAAGCATGACCTCTCCTGAATTAATGAAT
GCTTATAATTCAAATATTTTCCTTGCTGAAGATAGAGTCTTATCTTTAGCTTTAGTAAGT
CTTCCTGGACATCAGTATTTATTAAGATTCGTCCCTTCAGCTATTGCCGAAACTGATGTA
CCAGCAAAGTTGTTTCAATTATTAGCTCAAAGAAGAAGGTGGATAAATGGATCTTGGTTT
GCCCTTATTGATACATGGAGAACATTTTCTAGGATTAAAAATTCTGATCATACAAGATGG
AGGAAAATATGGTTTAGTTTTCAACTTGTGTATTTTGGTGTGACTATTTTGTTTACTTGG
GTTATGGTAGGGAGTTTTTATTTGTTTACAGAGTTGATTTTTGCAGCAATTTTTAAAGGG
TTTGATCAAAGTGCAGGGGGGATTATGACGTTGACTGAGTTTTTGTTATCGGTTTATATT
GCTATGATTTTGTTGGTTTTTATGATGAGTCTTGGAGTTAAGACAGGTAGGGTTGAAGGG
ACTTATAGGTTTATATCATTTGGGTTTTCTTTTTATATGCTTTTTACTTTTTTCTGCACG
ATGTATTATACATTTACTAGTAATTTGACCGTGTACTCTTGGTTTTTAGTTGCTGCTACA
ATTGGTTCTTATTCTATTGGCTTGCTGATTACTGGGAATACTAAGAAAGTTGCGTTGAGG
ACGGTGCAGTTTTTGATGATGACTCCGATTTATGTTAATGTTTTTCAAATCTACGCAATC
TGCAACATCCATGACTGTACCTGGGGTAACCGTCCAGACAACCTAACCGAAGAAGAAAAA
GCAAAACGTGAAGACTTCGAGCATTATCGTACAAAATGGGTTATAATATGGATAGTCTCC
AATCTAGTCTATGTAAAAATCTTTGAAACCTTCATCCAAATCGATAGTGAACTTATTGCC
CTTTATGTCCTTTACACAATGGCCATGATCTTAATCCTCATCCGTTTCTGTGGCTGTATC
GCATTTTATTTCTCAAATTGGTTTCAAAATAAAGGTAGTAAAAGATATATTCGTCTAGGA
TCAGTAGTTGAAGCTAATAAAGAAGATAAAAGAATCCTAACTGAAATAGTTCAAAAAGTT
AATAGAGGTAGGGCTATGAGTCAAAAAGAAATAAGGAACTCGATAATTGGGGTTATAGAG
AAAAAAGCTGGTAATAATGAAAGAAGGCAGACTCAATTCCAAAAAGATATTCTTAAAATG
TGTAGAAAATCAGAACTTCTTGAAGATGATGTTGAAGAAGAAGGTTATTCAGAAAGTATT
GAAGAAAACAGTAATGAAAGTGATGAAGATTGTAGTGAATATTATAATGCAAATTCTGGG
AAAACAAAGAAAATCAAAAAACAAACTAAGAAAACAAAAAAAACTAATGGGAAAAGCGTA
AAAAAATCAGTCAGGGAAAGTGTGAGGAAATCAGTTAGGGAAAGTAAAAGGGAAAAAAAA
GATGAGTCGAAGTTTTCCCCAATACAGTCGAAAGTGGATGCCAAAATTGATGCGAAAAAT
GCTGAAGGGATGATAAATTTCGAAGACACTATACAAAAAGATCCACTTTGGGAAAATGAT
GAAGAAGGGGAAGAGTCTAAAAACCAAGAAAGTGAAGTTAATAAGTATCTGGATATGCTT
TCTCTTATTATATCTAATATATCAGATTCAAATTAG