Identifiers and Description

Gene Model Identifier

SteCoe_11255

Standard Name

None

Aliases

None

Description

C2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002258700.0000000000002543665647376923XYPPX repeat family protein; I
nduced during dense core granu
le (DCG) regeneration; functio
n unknown; transcription induc
ed following exocytosis; may b
e cargo protein of dense core
secretory granules
Oxytricha TrifallaxContig8814.0.g370.0000000000018795288165390832C2 domain

WormBaseWBGene000067520.0024787521766663585

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11255(Protein)
MNQHGTLIIRPICARMTRDTDFLSKMDPYCIITLGSQKQKTRIASGAGKMPSWQDQFVFK
KTYEDTISVAVWDYDSNSRDDLVGEAVVPIGRILSTPNWDDWVELAYRGKKSGDIRLSTT
FTPDQQVGMQGGPQVIYQQVYNPMPGNIGYPSYPIIPPQLQGMGYPPPPPQFGAYGLPVP
IPGPMPGYPPQMMYGIPQQTPYPGTYTQPYPGPPPPYGYPPPPY


>SteCoe_11255(CDS)
ATGAATCAACACGGAACACTTATAATCCGACCAATATGCGCCCGAATGACCCGCGACACT
GATTTCCTATCTAAAATGGACCCTTACTGTATCATAACCCTCGGTTCTCAAAAGCAAAAG
ACTCGAATTGCCAGTGGTGCTGGGAAAATGCCTTCATGGCAAGATCAGTTTGTATTTAAA
AAAACATATGAAGATACTATTTCTGTAGCAGTTTGGGATTATGATAGTAATTCAAGAGAT
GATCTTGTAGGTGAAGCTGTTGTCCCAATAGGAAGAATTTTATCAACACCAAATTGGGAT
GATTGGGTTGAATTAGCATATAGAGGGAAAAAATCAGGAGATATTAGACTTAGTACAACT
TTTACTCCTGATCAACAAGTAGGAATGCAAGGAGGTCCTCAGGTTATATATCAACAAGTT
TATAATCCTATGCCTGGAAATATTGGTTATCCTTCTTATCCTATAATTCCACCTCAATTA
CAAGGTATGGGTTATCCACCACCACCACCACAATTTGGAGCTTATGGACTACCTGTACCT
ATACCAGGACCTATGCCTGGATATCCACCACAAATGATGTATGGAATTCCTCAACAAACA
CCTTATCCTGGAACATATACACAACCTTACCCTGGACCACCACCACCTTATGGATATCCA
CCACCACCTTATTAG