Identifiers and Description

Gene Model Identifier

SteCoe_11266

Standard Name

None

Aliases

None

Description

FA_desaturase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004442601.9792598779469045e-32Fatty acid desaturase family p
rotein; fatty acid desaturase-
related protein
Oxytricha TrifallaxContig19485.0.g951.603810890548638e-28Fatty acid desaturase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11266(Protein)
MLKSLYMHFYSEHLYGHHKYVSTPNDPATAKFGQTLYAYIPQTLKGSFINTWKRECKAAE
KLGKSPYSLHNHFIQWLSIEAIFTFSIWCAWGWKTLGLFLFQAFLSVWMLETINYIRHYG
LQRKKQANGLYEPVTTKHSWNAPQTLQNLILLKLQRHSDHHANAYKPYQTLLSCEDSPNL
PCGYAVCVLASFFPPVWFGIVNPLAEATNKQGRPNDEQMEKSNSSLKIWLAIQTSIVTIL
AIII


>SteCoe_11266(CDS)
ATGCTGAAAAGCTTGTATATGCATTTTTACTCTGAGCATCTTTACGGCCATCACAAGTAT
GTGTCAACACCTAACGATCCAGCAACAGCTAAATTTGGGCAAACTTTATATGCATATATT
CCTCAAACACTTAAAGGAAGCTTTATAAACACTTGGAAAAGAGAATGTAAAGCTGCTGAG
AAGCTAGGGAAATCTCCGTATAGTCTTCATAACCACTTTATTCAATGGCTATCAATAGAA
GCAATATTTACATTCAGCATATGGTGTGCATGGGGCTGGAAAACGCTAGGTTTATTTTTA
TTCCAAGCTTTTCTTTCAGTATGGATGCTTGAGACTATTAATTACATTCGACACTATGGC
TTGCAAAGGAAAAAACAAGCAAATGGACTTTATGAACCTGTGACAACAAAACATTCATGG
AATGCCCCTCAAACTTTACAAAACCTCATTCTTCTTAAACTACAAAGACATTCTGATCAT
CATGCTAATGCATATAAACCTTATCAAACTTTATTAAGCTGTGAAGATTCTCCTAATCTA
CCTTGTGGCTATGCTGTTTGTGTTTTAGCTTCATTCTTTCCCCCAGTATGGTTTGGAATT
GTTAATCCTTTAGCTGAAGCTACTAATAAACAAGGTCGACCAAATGATGAACAAATGGAA
AAAAGTAATAGTTCTCTTAAGATCTGGCTAGCAATCCAGACTTCAATAGTTACTATTTTA
GCTATAATTATTTAG