Identifiers and Description

Gene Model Identifier

SteCoe_11359

Standard Name

None

Aliases

None

Description

Cofilin_ADF domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007941500.000000002061153622438558Cofilin/tropomyosin-type actin
binding protein; principle a
ctin-modulating protein involv
ed in membrane deformations (i
ncluding phagocytosis, but not
cytokinesis) by severing and
depolymerizing F-actin.

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11359(Protein)
MKMDKDIKYIVFKIENQSTVVVDKVGEPNASERQFHHDVAQNEPRFIVFDFPAQTSDGLI
LNKLIFIHYCPDNSKVKDKMVYASTKENLKRRFVGLYKEIQASAHDELTFQSIASSIRL


>SteCoe_11359(CDS)
ATGAAGATGGACAAGGACATTAAATATATTGTATTCAAAATCGAAAATCAGAGTACTGTG
GTTGTAGATAAGGTTGGAGAACCAAATGCTTCTGAACGCCAATTCCATCATGATGTTGCC
CAAAATGAGCCTAGGTTTATTGTGTTTGATTTCCCTGCTCAAACTTCAGACGGTCTAATT
TTGAATAAATTGATTTTCATCCACTATTGCCCAGATAATTCAAAAGTTAAAGACAAAATG
GTCTATGCAAGCACCAAAGAAAATTTAAAGAGGAGATTTGTAGGACTCTATAAAGAAATA
CAAGCAAGTGCGCATGATGAACTTACATTCCAATCGATAGCATCATCTATAAGACTTTAG