Identifiers and Description

Gene Model Identifier

SteCoe_11384

Standard Name

None

Aliases

None

Description

Cyclin

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21039.0.g413.3057006267607343e-37Cyclin, N-terminal domain

Tetrahymena ThermophilaTTHERM_001965907.281290178321643e-33Cyclin, N-terminal domain cont
aining protein; Putative mitot
ic cyclin; similar to Parameci
um CYC1 and CYC2
Saccharomyces CerevisiaeYDL155W2.1151310375910805e-19B-type cyclin involved in cell
cycle progression; activates
Cdc28p to promote the G2/M tra
nsition; may be involved in DN
A replication and spindle asse
mbly; accumulates during S pha
se and G2, then targeted for u
biquitin-mediated degradation;
relative distribution to the
nucleus increases upon DNA rep
lication stress; CLB3 has a pa
ralog, CLB4, that arose from t
he whole genome duplication
WormBaseWBGene000008653.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11384(Protein)
MIRANPLEEPENKENIQQKSKSSLSFPTQRCFGTDLTKPISQSSQQSSNDPQLLDYYSEE
IYEYLKSIESHHKAKYGYMKQQTDISEKMRSVLIDWLVEVHFRFKLASETLFLAVNIIDR
YLEKTPICRSRLQLIGVSALLIASKYEDIYPPETRDLVYITDKAYTKEEILQTEAVILKV
LEYNITVPSAFRFLERYSRLAGCCEQQFALASYLQELALIDYNMLKYPNSMNAAASLYLM
FKIKEVKPEWTEELKKASGYLEEQIKPCAKEMCLLFQNASRSSLKGVKTKFSSAQYFHVA
NTTLL


>SteCoe_11384(CDS)
ATGATAAGGGCAAATCCCTTAGAAGAGCCAGAAAATAAAGAAAACATCCAGCAAAAAAGT
AAGTCCTCATTATCTTTTCCTACTCAGCGTTGCTTTGGCACTGATTTAACCAAGCCTATT
TCCCAATCTTCTCAACAAAGCTCTAACGACCCTCAACTTCTTGACTACTATTCAGAAGAA
ATTTACGAATATCTTAAATCAATCGAAAGCCATCATAAAGCAAAGTATGGGTATATGAAA
CAACAAACAGATATTTCAGAAAAAATGCGTTCAGTACTTATAGATTGGCTTGTAGAAGTG
CATTTTCGTTTCAAATTAGCTTCAGAAACCCTTTTTCTTGCAGTGAATATTATAGACAGA
TATTTAGAAAAAACTCCAATCTGTAGGTCGCGTTTACAATTAATTGGTGTTTCAGCATTA
CTTATAGCTAGCAAATATGAAGATATTTACCCTCCAGAAACTAGAGATCTTGTGTATATA
ACAGATAAAGCTTATACTAAAGAAGAAATTTTACAAACTGAAGCCGTGATATTGAAAGTT
TTAGAATATAATATAACAGTACCAAGCGCTTTTAGATTTTTAGAAAGGTATTCAAGGCTT
GCTGGATGTTGTGAACAACAATTTGCCCTTGCTAGTTATTTGCAAGAATTAGCTCTTATT
GATTATAATATGCTAAAGTATCCGAATTCTATGAATGCTGCAGCTTCATTATATCTTATG
TTTAAAATTAAAGAGGTTAAGCCTGAGTGGACTGAGGAGTTGAAGAAAGCTAGTGGGTAT
TTAGAAGAACAAATTAAACCATGTGCTAAAGAGATGTGCTTATTATTTCAGAATGCTTCT
AGGTCTAGTTTAAAAGGGGTCAAAACAAAATTCTCATCAGCACAATATTTTCATGTAGCT
AATACTACATTGTTATAA