Identifiers and Description

Gene Model Identifier

SteCoe_11568

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000068331.8521167695179754e-45
Oxytricha TrifallaxContig22591.0.g1125.0345753587649823e-45Ras family

Tetrahymena ThermophilaTTHERM_004677907.47197233734299e-43Similar to Rab2; putative inte
rmediate compartment protein;
putative involvement in regula
ted secretion
Saccharomyces CerevisiaeYER031C4.359610000063081e-28Rab family GTPase; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi; YPT31 ha
s a paralog, YPT32, that arose
from the whole genome duplica
tion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11568(Protein)
MSYSYLFKYIIIGDTGVGKSCLLLQFTDKRFRHDHDLTIGVEFGSRMIRIDDKDVKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFTHLSNWLQDARENGNADMAITLVANK
TDLDSRRTVTSEEGEIFARENNLIFIEASAKNSTNVEEAFEVTARSIYSKVKEGSLDISS
ETCGVRMGPNSVSVSRTMPSAKRECC


>SteCoe_11568(CDS)
ATGTCTTATTCATATCTATTTAAGTACATCATCATAGGAGATACGGGTGTTGGGAAATCA
TGCCTGCTTTTACAGTTTACAGACAAGCGTTTCCGACATGATCATGACCTGACAATTGGA
GTTGAGTTTGGTTCACGGATGATAAGAATTGATGACAAAGATGTAAAACTACAAATCTGG
GATACAGCAGGTCAAGAAAGTTTTAGATCAATTACACGTTCTTATTATCGTGGTGCAGCT
GGTGCATTATTAGTTTATGATATAACAAGACGTGATACATTTACTCATTTATCAAATTGG
CTTCAAGATGCAAGAGAAAATGGTAATGCTGATATGGCTATAACACTTGTGGCAAATAAA
ACTGATTTAGACTCAAGAAGAACTGTAACTTCAGAGGAAGGGGAAATATTTGCTAGGGAG
AATAATTTGATATTTATTGAAGCATCAGCTAAGAATAGTACAAATGTTGAAGAAGCATTT
GAGGTTACTGCTAGGAGTATATATTCTAAGGTTAAAGAAGGTAGTTTGGATATTAGTAGT
GAAACTTGTGGAGTGAGAATGGGCCCAAATTCGGTATCAGTATCTAGAACAATGCCCTCA
GCAAAGAGAGAATGCTGCTGA