Identifiers and Description

Gene Model Identifier

SteCoe_11752

Standard Name

None

Aliases

None

Description

tRNA-synt_1b domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003004701.3336148155022614e-34tyrosyl-tRNA synthetase family
protein
Oxytricha TrifallaxContig22340.0.g912.6786369618080778e-33tRNA synthetases class I (W an
d Y)

Saccharomyces CerevisiaeYPL097W5.900090541597061e-29Mitochondrial tyrosyl-tRNA syn
thetase
WormBaseWBGene000069689.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11752(Protein)
MNFIRLLQSRFLLKDMINTCESYTNRSIYCGFDPTASSLHLGHLCALNSLAYASSLSFNP
IAILGTATALIGDPSGKTESRPLIDNETISKNTLSLSSQIHKVFTNLQKKLNSPCAELKV
IENGIFYTNLDLIKFLREVGYYFPVNPLINRDFVQKRADGVTYTEFSYGLLQAYDFLTLF
EKYDCVGQIGGSDQWSNITSGTELIRKKLGKHSFGCTLPLLTTKDGKKFGKTEGNALFLD
KNKTKSYDIYQYCYNLPDDEIEKLLYRLTFVSSEKIIETLDQPLETRSGQKLLAYEIIST
LHGDQEAKNTQRISEILFKEDYNNIVPSDLEALSEYANKIVISQEDIGKNIIDLLKEKAV
TQSKKDIRRLIENGSVKVNGQVCKEDSKLKEFSPVGGLAFVITTGKKKMHLGYLQ


>SteCoe_11752(CDS)
ATGAACTTCATCAGACTCCTCCAATCACGTTTTCTTCTAAAAGACATGATAAATACTTGT
GAATCCTACACAAACCGATCAATATATTGTGGTTTTGACCCAACAGCTTCCTCTTTACAT
CTTGGTCATTTATGTGCTTTAAATTCTTTAGCATATGCAAGTTCCTTATCTTTTAACCCA
ATAGCAATATTAGGAACAGCAACAGCTCTTATAGGTGATCCATCAGGAAAAACAGAATCT
CGTCCTTTAATAGATAATGAGACAATATCAAAAAACACTTTATCATTATCATCTCAGATC
CATAAAGTATTTACAAATCTTCAAAAGAAATTAAATAGTCCATGTGCTGAACTTAAGGTT
ATAGAAAATGGGATTTTCTATACAAATTTGGACTTAATAAAATTCTTAAGAGAAGTCGGG
TATTATTTTCCTGTTAATCCTTTGATAAATAGAGATTTTGTTCAAAAAAGGGCAGATGGG
GTGACTTATACAGAGTTTTCATATGGGTTATTACAAGCTTATGATTTTTTGACACTTTTT
GAGAAATATGATTGTGTTGGGCAGATTGGAGGAAGTGATCAATGGAGTAATATTACATCT
GGGACTGAGCTTATAAGGAAAAAACTGGGAAAACATAGTTTTGGATGCACATTACCTCTT
TTAACTACTAAAGATGGGAAAAAATTTGGCAAAACTGAAGGAAATGCGCTGTTTTTAGAT
AAAAACAAAACTAAGTCTTATGATATATACCAATATTGTTATAATCTACCTGATGATGAA
ATAGAAAAACTTTTGTATCGACTTACATTTGTATCTTCTGAAAAAATCATTGAAACTTTA
GATCAACCTTTAGAGACAAGAAGTGGACAAAAACTTTTAGCATATGAAATAATCAGCACA
TTACATGGTGATCAAGAAGCTAAAAATACACAAAGAATAAGCGAGATACTTTTTAAAGAG
GATTACAACAATATTGTTCCTAGTGATCTTGAAGCACTTTCTGAATATGCGAATAAAATT
GTGATTAGCCAAGAAGATATTGGGAAAAATATCATTGATTTACTTAAAGAAAAAGCTGTA
ACTCAAAGTAAAAAAGATATTAGAAGACTAATAGAAAATGGGTCAGTTAAAGTAAATGGG
CAGGTGTGCAAAGAAGATAGTAAGCTTAAAGAATTTTCACCTGTAGGAGGACTTGCGTTT
GTTATAACAACAGGCAAGAAGAAAATGCATTTAGGATATTTACAGTAA