Identifiers and Description

Gene Model Identifier

SteCoe_11769

Standard Name

None

Aliases

None

Description

kinase related to cdc2 subfamily

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010354907.667648073722e-53Protein kinase domain containi
ng protein. Sequence similarit
y to the CDC2 subfamily of the
protein kinase CDK family (Ei
sen et al., 2006)."
Saccharomyces CerevisiaeYBR160W5.665668176358939e-52Cyclin-dependent kinase (CDK)
catalytic subunit; master regu
lator of mitotic and meiotic c
ell cycles; alternately associ
ates with G1 (CLNs), S and G2/
M (CLBs) phase cyclins, which
provide substrate specificity;
regulates cell cycle and basa
l transcription, chromosome du
plication and segregation, lip
id biosynthesis, membrane traf
ficking, polarized growth, and
morphogenesis; abundance incr
eases in DNA replication stres
s; transcript induction in osm
ostress involves antisense RNA
Oxytricha TrifallaxContig5189.0.g915.665668176358939e-52Protein kinase domain

WormBaseWBGene000004054.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11769(Protein)
MNFGESTADRYEKIEKIGTGTYGVVYKAKDKVRNDFCALKKILLDVEPEGIPSTAIREIC
ILRELQNPNIVDLRDVVASDDKLYLVFEYVDQDLKQFLDSIPKDQFVDAKIIKSLLYQLV
QAVAYLHSKRILHRDLKPQNILITKNGCVKLADFGLARTYQIPLRPYTHEVVTLWYRAPE
ILLGTLEYSSALDVWSLGTIFLELLTKSPFFVGDSEIDQLYKIFRILGTPNEKMWPGVSK
LRDYKRTFPNWSATNLRTCLHNVDVAGLDLLQRMLNYDPAARITAKEALAHQYFNDVNVP
AW


>SteCoe_11769(CDS)
ATGAATTTTGGAGAGTCCACTGCAGATCGCTATGAGAAAATCGAGAAAATAGGTACTGGG
ACATATGGAGTAGTTTATAAAGCTAAAGACAAGGTTCGAAATGATTTCTGTGCTTTGAAA
AAAATTCTCCTTGACGTTGAACCTGAAGGTATCCCATCTACAGCGATAAGAGAAATTTGC
ATATTAAGGGAACTACAAAACCCTAATATTGTTGATTTACGTGATGTTGTTGCAAGTGAT
GATAAATTATATCTGGTATTCGAGTATGTTGATCAAGACTTAAAACAATTTCTAGACTCG
ATTCCTAAAGATCAATTTGTCGATGCAAAAATTATCAAGAGTCTTTTATATCAACTAGTC
CAAGCAGTTGCGTATTTACACTCAAAAAGGATTCTTCATAGGGATTTAAAGCCTCAGAAT
ATTTTAATAACAAAGAATGGCTGTGTGAAATTAGCTGACTTTGGCCTTGCAAGAACTTAT
CAAATACCATTACGACCATATACTCATGAAGTTGTTACTCTATGGTATAGAGCTCCAGAA
ATATTATTAGGTACATTAGAATATTCTTCAGCTTTAGATGTATGGTCATTAGGAACTATA
TTCTTAGAGCTTTTAACAAAATCCCCATTCTTTGTAGGGGATTCAGAAATCGATCAACTT
TATAAAATATTTCGCATATTAGGAACACCTAATGAGAAAATGTGGCCTGGGGTTTCAAAA
CTTAGAGATTATAAAAGAACATTCCCCAATTGGTCTGCTACAAATTTGAGGACCTGCCTT
CATAATGTGGATGTAGCTGGATTAGACCTGTTACAGAGAATGCTTAATTATGACCCTGCT
GCGAGAATTACAGCAAAGGAAGCTTTAGCGCATCAGTATTTTAATGATGTTAATGTCCCA
GCTTGGTAG