Identifiers and Description

Gene Model Identifier

SteCoe_11976

Standard Name

None

Aliases

None

Description

PGM_PMM_I domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • intramolecular transferase activity, phosphotransferases (IEA) | GO:0016868

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15616.0.g430Phosphoglucomutase/phosphomann
omutase, alpha/beta/alpha doma
in I

WormBaseWBGene000198904.020060215743355e-74
Saccharomyces CerevisiaeYMR105C5.814040485895939e-62Phosphoglucomutase; catalyzes
the conversion from glucose-1-
phosphate to glucose-6-phospha
te, which is a key step in hex
ose metabolism; functions as t
he acceptor for a Glc-phosphot
ransferase; protein abundance
increases in response to DNA r
eplication stress; PGM2 has a
paralog, PGM1, that arose from
the whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_11976(Protein)
MDIMAAIRIVQTTPIPGMKAGTSGLRKKVVEASQANYVENFTQCVFSVYSEKENIEGCTM
VVGGDGRFYNKQAIQKIFKVAAANKIGRIWVGENGILSTPSVSIIIREREDGISKGGLIL
TASHNPGGPNGDFGIKFNGENGSSAVEEITNKIYEESLKIETYKIADLPEIDISTIGSQT
FDVEGHPFVVEVISSTEDYIRKMRSIFDFNKIKILLDRPDFSMVYDCMHGVAGPYVRAIF
GDILGVPSGNLMNSTPLEDFGGGHPDPNLIYAHDLVKVMGVGKDHGIFPSFGAANDGDAD
RNMVLGKQFFVVPSDSVAVIAANYSCIPSFPQGCIGAARSMATSLALNAVAEKLGFPLFE
TPTGWKFFGNLMDAGKINLCGEESFGTSSDHCREKDGIWAVLCWLSILAHKNEGRAELLS
VKDVLSEHWRTYGRNYYIRHDYERCDSDQAKAFMKSLEEKFPIFEGKADNFSYHDPVDNS
TSSNQGLRFIKGNWRVVFRLSGTDSVGSTVRIYFEKHETENLEMETEAALQDVSLLMYIN
YLEEKNLMSLLRIKLIRNYYYLALFCERIFAIVFMI


>SteCoe_11976(CDS)
ATGGATATAATGGCAGCTATTCGTATTGTACAGACTACTCCGATTCCTGGGATGAAAGCT
GGGACATCCGGGTTGAGGAAAAAAGTTGTTGAAGCTTCTCAGGCAAATTATGTAGAGAAC
TTCACTCAATGTGTATTCAGTGTGTATTCTGAAAAGGAGAACATTGAAGGATGCACAATG
GTTGTTGGTGGTGATGGAAGGTTTTACAACAAACAAGCTATACAGAAAATATTTAAAGTT
GCAGCTGCTAATAAAATCGGCAGGATCTGGGTTGGGGAAAATGGGATTTTATCAACACCA
TCTGTGTCGATTATTATAAGAGAACGTGAAGATGGAATTTCTAAAGGAGGTTTGATTTTA
ACTGCAAGCCATAATCCTGGTGGACCAAATGGGGATTTCGGAATCAAGTTCAATGGGGAA
AATGGAAGTTCAGCAGTAGAAGAAATCACTAATAAAATATATGAGGAAAGCTTGAAAATC
GAAACTTATAAAATCGCTGATCTCCCTGAGATTGATATTTCTACTATCGGTAGTCAAACT
TTTGATGTTGAAGGACATCCTTTTGTTGTTGAGGTTATAAGTTCAACAGAAGATTATATT
AGAAAAATGAGGAGTATTTTTGATTTCAACAAAATCAAAATTCTTTTAGATAGACCTGAT
TTTTCAATGGTTTATGATTGCATGCATGGTGTTGCTGGACCTTATGTTAGAGCTATATTT
GGGGATATACTTGGAGTTCCTTCTGGAAATCTTATGAATAGTACACCTCTTGAGGATTTT
GGTGGTGGACATCCAGACCCAAATTTAATTTATGCTCATGATCTTGTTAAAGTTATGGGT
GTTGGCAAGGATCATGGTATTTTCCCAAGTTTTGGTGCAGCGAATGATGGTGATGCTGAT
AGAAACATGGTTTTAGGTAAGCAATTTTTTGTAGTCCCATCAGATTCAGTAGCTGTAATT
GCCGCAAATTACTCCTGTATTCCTAGTTTCCCACAAGGATGTATTGGCGCTGCAAGAAGC
ATGGCAACTAGTTTAGCTTTAAATGCTGTAGCTGAAAAACTTGGCTTCCCATTGTTTGAA
ACTCCAACTGGATGGAAATTCTTTGGGAATTTAATGGATGCCGGGAAAATCAACTTGTGT
GGTGAAGAAAGTTTTGGAACTAGTAGTGACCATTGTAGAGAAAAAGATGGTATTTGGGCT
GTTTTGTGCTGGTTGAGCATTTTGGCTCATAAAAATGAAGGTAGGGCTGAACTTCTTAGT
GTTAAAGATGTACTTTCAGAACACTGGCGAACTTATGGTAGAAATTATTATATAAGACAT
GATTATGAAAGATGTGATTCTGATCAAGCTAAAGCTTTTATGAAAAGTTTAGAAGAGAAA
TTCCCAATTTTTGAAGGCAAAGCTGATAATTTCTCATATCATGACCCAGTTGATAATTCG
ACTAGTAGTAATCAAGGTTTGAGGTTTATTAAAGGAAACTGGAGAGTTGTGTTTAGGCTT
TCTGGGACAGATTCTGTTGGTTCGACAGTGAGGATTTACTTTGAAAAACATGAGACTGAG
AATTTGGAAATGGAAACTGAAGCGGCTCTTCAAGATGTCAGTTTACTAATGTACATCAAT
TACTTGGAAGAGAAAAACCTGATGTCATTACTTAGGATTAAGCTAATTAGAAATTACTAT
TATTTGGCTTTATTTTGTGAGAGGATTTTTGCAATAGTTTTTATGATTTAG