Identifiers and Description

Gene Model Identifier

SteCoe_120

Standard Name

None

Aliases

None

Description

CDC73_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007604905.242885663363464e-22member of S.cerevisiae PAF com
plex
Oxytricha TrifallaxContig3758.0.2.g530.00000000003775134544279098RNA pol II accessory factor, C
dc73 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_120(Protein)
MSTHHDPISLLKDYMSNSKKIDSVGGKLYFNNLEIPLTHLTAWKPKQSGKQYSIGSLWFF
LQNSGLNKGDYARAASKAGAGVEMVSIPDRSEVLAYFQGGKDTTDCIDEELRASTLIEKV
AEETKNASREALERPLCTKESLLQTPSVSYKYLLTYCKDNLKHKKRQREISATSLLEEIL
SGPDNHPEHQPRPIIIVPSAGTPGGICYANALEFLEKGNYVDPNNVTGIMPSGPLCFNKK
IKGRMITFEVYDQTLGFSKAHWRRAVAVFVQGPRYQFKDWPLANDLITLFLTMRGFYLNY
QDSPIEENVKKLYVKILQISRNKRHLDKTIQHEFWCDLEKFIFSPRYKSK


>SteCoe_120(CDS)
ATGTCGACTCATCATGATCCAATAAGTTTACTTAAAGACTATATGAGTAATTCAAAAAAA
ATCGACTCTGTTGGAGGAAAACTTTACTTTAACAACCTAGAAATCCCTTTAACCCATCTA
ACAGCTTGGAAACCTAAACAATCAGGAAAACAATATTCAATAGGTAGTTTATGGTTTTTC
TTACAAAACTCAGGATTAAATAAAGGAGATTATGCAAGAGCTGCAAGTAAAGCAGGTGCA
GGTGTTGAAATGGTCAGTATCCCAGATCGTTCTGAAGTCTTAGCATATTTCCAAGGAGGA
AAAGACACAACAGATTGTATAGATGAAGAACTTCGAGCTTCAACTTTAATAGAAAAAGTT
GCTGAAGAAACAAAAAATGCTTCAAGAGAAGCTTTAGAAAGACCTTTGTGTACTAAAGAA
AGTTTACTTCAAACTCCAAGTGTTAGTTATAAATACTTATTGACTTATTGTAAAGACAAT
TTAAAACATAAAAAAAGACAGAGAGAAATTAGTGCTACAAGTTTATTAGAAGAAATATTA
AGTGGACCTGATAATCATCCTGAACATCAGCCAAGACCGATTATTATTGTCCCATCAGCA
GGTACACCTGGGGGGATTTGTTATGCAAATGCCCTTGAATTTTTAGAAAAAGGGAATTAT
GTTGACCCAAATAATGTTACAGGAATAATGCCTAGTGGACCTTTATGTTTTAATAAGAAA
ATCAAAGGCCGGATGATAACTTTTGAGGTTTATGATCAGACGCTTGGGTTTAGTAAAGCG
CATTGGAGAAGGGCGGTGGCTGTTTTTGTTCAAGGACCGAGGTATCAGTTTAAGGATTGG
CCTTTAGCTAATGACCTTATTACATTGTTTTTGACGATGAGAGGGTTTTATTTGAATTAT
CAAGACTCACCTATTGAGGAAAATGTTAAGAAATTGTATGTGAAAATACTACAGATTAGT
AGAAATAAGAGGCATTTGGACAAAACGATACAACATGAGTTTTGGTGCGATTTAGAGAAA
TTTATATTTTCACCTAGGTATAAGTCTAAATAA