Identifiers and Description

Gene Model Identifier

SteCoe_12356

Standard Name

None

Aliases

None

Description

Spc97_Spc98 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22101.0.g330Spc97 / Spc98 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12356(Protein)
MKSLDPSQLCFGTKVAIRNSHNHKYLKANKTDNIVTANGVHPTLSYSGCDTTQEFIIISS
TQGKDYRGPVTFSSVILLETQDDGFLSFTTQNEVKIEKADSAANKKLIKWTLVEPNVSSS
KRVVTTYDQVTFKTVFGELVINQSGGVMANGQATSAESTWKILKANVPFMPDWVYTRVNL
NHNDLVLSRSPLGDNFSLKPSVKRKTFSDENKGLGKLPLAAQEKLLMEDLLYTLLSIEGN
YIKRKQTDLSYAVEPYLEAPTCDESLLYVVNNVLPLCEQHDKICVFVNLHSYYEGGLVSH
ALCEAISTLLKEYKLKIIQIDAELEKGELTLPKLWFYIQPCMRTLECLNKFVEEAEHQKG
GALLNTLFKSMLSASDAIHKKLFAFLLEKASVPYLEMLSKWIHFGEIEDPYEEFLIKEHK
ELSKENLHKDFNDKYWDERFEFREAQIPLFLQKLTAKVLFTGKYLNVIRECGRVIHCPYS
EELDPKKNTKLLSNIGNQREFLEPIEHAYDWASKQLLNLILEEQQLLNRLKSIKHYFFLD
HGDFFVHFMDSAQEELEKHASAVSREKLESLLDLSLRTSSANSDPFKDDLSCELHTYTLS
EQLYAMHNISGNQAGSEDMQPIFTMPQIFKGLETFVLDYKVRWPLTLIISRKALTKYQLI
FRHLFFCKYVERQLSNTWILHQSTKDLALHKAFSTSYCLRQRMLHFVKNYVYYMTVEVLE
DKWHRFLEGLKKVQTVDEIMNLHTVFLDECLKECLLMDQELFMILNKIIGFCLYFSEMIE
QNTKSMKVDDSFLSQAFLDDTKSKTTDKKRVKGRENSTGTAEKLLARKKYSHLIENYSTK
FDEHLSNFLKTIDRNRSRSETHLINLIIRLDYNDYYSENRKMLDEKN


>SteCoe_12356(CDS)
ATGAAATCCTTGGACCCATCACAATTATGCTTTGGTACCAAAGTAGCTATTCGGAACTCT
CATAATCACAAATATCTTAAAGCTAACAAAACTGACAACATAGTAACAGCAAATGGTGTT
CACCCAACCCTATCTTACTCTGGCTGTGACACAACCCAAGAATTCATAATCATCAGTAGT
ACCCAAGGTAAAGATTATCGCGGGCCAGTCACATTTTCTTCAGTAATTCTCTTAGAAACC
CAAGATGATGGCTTTTTATCTTTTACTACACAAAACGAGGTCAAAATCGAAAAAGCTGAT
TCAGCCGCCAATAAAAAACTCATCAAGTGGACCTTAGTTGAACCTAATGTTTCATCTTCA
AAACGAGTAGTCACAACTTATGATCAAGTTACATTTAAAACAGTCTTTGGAGAATTAGTT
ATAAATCAATCAGGTGGGGTTATGGCTAATGGGCAAGCTACCTCAGCTGAAAGTACATGG
AAAATCCTAAAAGCTAATGTCCCATTTATGCCAGATTGGGTATATACAAGAGTAAATCTT
AATCATAATGATCTTGTATTATCTAGAAGTCCTTTAGGAGACAACTTCTCTTTAAAACCC
TCTGTAAAAAGAAAAACATTTAGTGATGAAAATAAAGGCCTTGGAAAACTCCCTTTGGCT
GCTCAAGAAAAACTTCTTATGGAAGATTTACTTTATACTTTATTGAGTATTGAAGGGAAT
TATATTAAAAGGAAACAAACTGATTTGAGTTATGCAGTTGAACCATATTTGGAAGCACCA
ACTTGTGATGAAAGTTTGTTGTATGTTGTGAATAATGTATTACCTTTATGTGAACAACAT
GATAAGATTTGTGTGTTTGTGAATTTACATAGTTATTATGAAGGAGGATTAGTTAGTCAT
GCTTTATGTGAAGCGATAAGTACTTTACTTAAAGAGTATAAACTGAAAATTATACAGATC
GATGCGGAGTTAGAGAAAGGCGAGCTTACTTTGCCGAAATTGTGGTTTTATATACAACCT
TGTATGAGAACTTTGGAGTGCCTTAATAAATTTGTTGAAGAAGCTGAGCATCAGAAAGGT
GGAGCTTTGTTAAATACGCTGTTTAAAAGTATGTTATCAGCTAGTGATGCTATTCACAAA
AAACTCTTCGCTTTCCTATTAGAAAAAGCTTCCGTGCCATATCTAGAAATGCTAAGCAAA
TGGATTCACTTTGGTGAGATTGAAGACCCATATGAAGAGTTCTTAATAAAAGAGCATAAA
GAGTTATCTAAAGAAAACCTACACAAGGATTTTAACGACAAATACTGGGATGAAAGGTTT
GAGTTCCGAGAAGCCCAAATCCCTCTATTTCTTCAAAAGCTTACAGCTAAAGTTCTTTTT
ACAGGAAAATACTTAAATGTAATTCGAGAATGTGGAAGAGTAATTCATTGCCCATACAGC
GAAGAATTAGATCCAAAAAAGAACACAAAGCTCTTATCAAATATCGGTAATCAAAGAGAA
TTTCTTGAGCCAATCGAACATGCATATGACTGGGCTTCAAAACAGCTTCTAAATCTTATC
CTTGAAGAACAACAACTATTAAACCGTCTCAAATCTATAAAACACTACTTTTTCTTAGAC
CATGGAGATTTCTTTGTTCATTTTATGGACTCAGCACAAGAAGAGTTAGAAAAACATGCA
AGTGCTGTGTCAAGAGAAAAACTTGAAAGCCTTTTAGATCTCTCTTTACGAACTTCTTCA
GCTAATTCTGACCCATTCAAAGATGATCTTAGTTGTGAACTTCACACTTACACCCTAAGC
GAACAACTTTACGCAATGCACAACATCAGTGGTAACCAAGCTGGATCTGAAGATATGCAG
CCAATATTCACAATGCCACAAATCTTTAAAGGTCTTGAAACTTTTGTCCTCGATTACAAA
GTCCGTTGGCCCCTAACATTAATCATATCCCGTAAAGCATTAACAAAATATCAGCTTATT
TTCCGTCATCTTTTTTTCTGCAAATATGTTGAAAGGCAACTTAGTAATACTTGGATTCTT
CATCAATCAACTAAAGATCTTGCTTTACATAAAGCTTTCTCAACAAGTTATTGCTTAAGA
CAACGAATGCTACATTTTGTTAAAAATTATGTTTATTATATGACTGTAGAGGTATTAGAA
GACAAATGGCATAGGTTTTTAGAAGGGCTTAAAAAAGTTCAGACTGTTGATGAAATAATG
AATTTACATACAGTTTTTTTAGATGAATGTTTAAAAGAATGTTTACTAATGGATCAGGAA
TTGTTTATGATTCTAAATAAAATTATTGGCTTTTGCTTGTATTTTTCTGAGATGATTGAG
CAAAATACAAAGTCTATGAAAGTTGATGATTCTTTTTTGAGCCAAGCATTTTTGGATGAT
ACAAAAAGCAAAACAACGGATAAAAAGAGGGTTAAGGGAAGGGAAAACTCAACTGGGACT
GCTGAGAAATTGTTGGCGAGGAAGAAGTATAGCCATTTGATTGAGAATTATAGTACGAAA
TTTGATGAACATTTGAGCAATTTTTTGAAGACTATTGATAGGAATAGGAGCCGTAGTGAA
ACGCATTTGATCAATTTGATTATTAGACTGGATTACAATGATTATTATAGTGAGAATAGG
AAAATGCTTGATGAAAAAAATTAA