Identifiers and Description

Gene Model Identifier

SteCoe_12639

Standard Name

None

Aliases

None

Description

PGK domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig392.1.g737.362997122252211e-76Phosphoglycerate kinase

WormBaseWBGene000201857.362997122252211e-76
Tetrahymena ThermophilaTTHERM_009294502.001470128041443e-75Phosphoglycerate kinase; glyco
lytic enzyme that catalyzes th
e conversion of 3-phospho-D-gl
ycerate to 3-phospho-D-glycero
yl phosphate
Saccharomyces CerevisiaeYCR012W6.542840619051457e-693-phosphoglycerate kinase; cat
alyzes transfer of high-energy
phosphoryl groups from the ac
yl phosphate of 1,3-bisphospho
glycerate to ADP to produce AT
P; key enzyme in glycolysis an
d gluconeogenesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12639(Protein)
MLARKLQITQIVEELKDQRVLMRADFNVPIKNGKIADLTRINSTVPTINLILSSGAKSLV
LMSHLGRPDGLPDPKSSLQIVATELERILARPVTFLNECVGEAVVAACRDPAPGSVFLLE
NLRFHPEEEGTGKDAQGGKVKPAKEAVQAFRDSLTALGDIFINDAFGTAHRAHSSMVGVN
LPRRAAGLLMGKEIEYFAKVLENPQRPLLVIMGGAKVKDKIQLIINLLDKCNEMIIGGGM
AFTFLKKTKGISIGSSLYDEEGSNIVEAILKKAEEKGVQIHLPLDYVCGDKFKEDANVQT
LEGDIPDGWMGLDIGPKSIEAMTAAIARANTVVWNGPPGVFEMAPFRGGSVAFFEEICKG
SERGLASIVGGGDTANFVQSMGERVSHISHISTGGGASLELMEGKELPGVLYLSDIN


>SteCoe_12639(CDS)
ATGTTAGCCAGAAAGCTCCAAATAACCCAAATAGTCGAAGAACTAAAGGATCAAAGAGTT
TTAATGAGAGCAGACTTTAACGTTCCTATCAAGAACGGTAAGATTGCTGACCTAACTCGT
ATAAACTCTACTGTTCCGACAATCAACTTAATACTCTCATCGGGTGCTAAGAGCTTAGTG
CTAATGAGTCACTTAGGTCGACCTGATGGACTTCCTGATCCTAAATCCTCACTTCAAATT
GTTGCAACTGAACTTGAGAGAATTTTAGCTCGTCCTGTCACTTTTCTTAATGAATGTGTT
GGTGAAGCAGTCGTAGCAGCTTGCCGCGATCCTGCTCCAGGCTCAGTATTTCTTTTAGAA
AACCTCCGTTTCCATCCTGAAGAAGAAGGTACTGGTAAAGATGCTCAAGGTGGGAAAGTT
AAACCAGCTAAAGAAGCTGTACAAGCTTTTAGAGATAGTCTTACTGCTCTTGGTGATATT
TTCATTAATGATGCTTTTGGCACAGCACACAGAGCTCACAGCTCTATGGTCGGAGTTAAC
CTACCAAGAAGAGCAGCTGGACTTCTCATGGGCAAAGAAATCGAATACTTTGCTAAAGTT
CTAGAAAATCCTCAAAGACCTTTACTCGTCATAATGGGTGGAGCTAAAGTTAAGGACAAG
ATTCAACTTATAATAAACCTTCTTGATAAATGCAATGAAATGATTATCGGTGGTGGCATG
GCTTTCACATTCCTCAAAAAAACTAAAGGAATTTCAATTGGCAGTTCATTATACGATGAA
GAAGGAAGCAATATCGTAGAAGCTATTCTTAAAAAAGCTGAAGAAAAAGGTGTTCAAATC
CATTTACCATTAGATTATGTTTGTGGAGATAAATTCAAAGAAGATGCTAATGTTCAAACT
CTTGAAGGAGATATTCCTGATGGATGGATGGGATTAGATATTGGCCCTAAGAGTATTGAA
GCTATGACTGCGGCAATTGCTAGAGCTAATACTGTTGTATGGAATGGACCTCCTGGTGTT
TTTGAAATGGCTCCTTTTAGAGGTGGATCTGTTGCATTCTTTGAAGAAATATGTAAAGGA
TCAGAAAGAGGGCTAGCAAGCATTGTTGGTGGTGGAGATACTGCTAACTTTGTCCAATCT
ATGGGAGAACGTGTTTCTCACATCAGCCATATCAGCACTGGTGGAGGTGCTTCATTAGAA
CTTATGGAAGGAAAAGAACTCCCTGGTGTCCTTTACTTATCAGATATTAATTAG