Identifiers and Description

Gene Model Identifier

SteCoe_12678

Standard Name

None

Aliases

None

Description

Ribosomal_L1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010542201.0530617357553812e-20L1P family of ribosomal protei
ns containing protein
Oxytricha TrifallaxContig17599.0.g526.305116760146989e-16Ribosomal protein L1p/L10e fam
ily

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12678(Protein)
MPFFSLLFRTFALQKSKATKYSPLDAIKILREGIVQPKIESFTIILRLGVDPTKGDHMVR
GNVYMPSGTGKRRKIAVFIHEEHKDLAIKLGAKYAGDDLLKQVKEGIIDFEQVLATAEMA
DALKPYARTLGQRGLMPTTRNGTMIPFSDLEMEMEKLRKGMVNYKMSKSATIQASLGKVR
FTDEEIIENFKAFMQNVIEEKPKNSIRAFLKKSYLTTTYGKSVLLDTRLIDPTNAKYILD
SLR


>SteCoe_12678(CDS)
ATGCCTTTTTTTTCATTGCTATTTAGGACCTTTGCATTACAAAAAAGTAAGGCAACAAAA
TACTCACCCTTAGATGCCATAAAAATTCTTCGTGAAGGGATTGTTCAGCCAAAAATCGAA
TCATTCACCATTATCCTCAGATTAGGTGTCGACCCAACCAAAGGTGATCATATGGTCAGA
GGTAATGTTTATATGCCATCAGGCACAGGAAAGAGAAGGAAAATTGCTGTTTTTATTCAT
GAAGAACATAAAGACTTAGCCATAAAACTTGGAGCCAAATATGCAGGGGACGATTTATTA
AAACAAGTCAAAGAAGGGATTATTGATTTCGAACAAGTCTTAGCAACTGCAGAAATGGCT
GATGCTTTAAAACCATATGCAAGAACTTTAGGTCAAAGAGGTCTTATGCCAACAACCAGA
AATGGAACTATGATTCCATTTAGTGATTTAGAAATGGAAATGGAAAAGCTTAGGAAAGGT
ATGGTTAATTATAAAATGTCTAAATCGGCTACGATACAAGCATCTCTAGGTAAAGTACGG
TTTACTGATGAAGAGATTATTGAAAATTTTAAAGCTTTTATGCAAAATGTTATTGAAGAG
AAGCCGAAGAATTCTATTAGGGCATTTTTGAAAAAATCATATCTGACAACTACTTATGGA
AAAAGTGTATTGCTGGATACAAGACTTATTGACCCAACGAATGCTAAATATATTCTTGAT
AGTCTTAGATAA