Identifiers and Description

Gene Model Identifier

SteCoe_12766

Standard Name

None

Aliases

None

Description

Kinesin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12475.0.g10Kinesin motor domain

Tetrahymena ThermophilaTTHERM_003005007.175095973164411e-66Kinesin motor domain containin
g protein
Saccharomyces CerevisiaeYGL216W1.368539471173853e-44Kinesin-related antiparallel s
liding motor protein; involved
in mitotic spindle positionin
g; sliding activity promotes b
ipolar spindle assembly and ma
intenance of genome stability;
inhibits spindle elongation,
destabilizing late anaphase sp
indle microtubules that polyme
rize beyond the midzone
WormBaseWBGene000022243.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12766(Protein)
MLNKKPVEKRDTEQEDVDIHSSMQQGMSNILVSVRVRPLSKKELEVDSRCLVHTLDNNLV
VLLDPTADINLPEDSFRSNRSREKQYAFDMAFDKSSTQEAIFEKTTKFLIDGVANGYNAT
VFAYGATGAGKTHTMIGDADKPGLMLLTFEDIFACLDRLSIERQYKVRLTYLEIYNEEVR
DLFTTNRISESLDIREDSIKGVTVVGLSELMVTSAKEVVNHIRNGNKRRTCEPTMANETS
SRSHAVLQIIVEYKDKASGLDADIISGKLSLIDLAGSERASTTKNRGIRLLEGANINRSL
LALGNCINALYENSEKGTKIFIPYRDSKLTRLLKDSLGGNCRTVMIACVSPSYGSFEDTH
NTLTYANRAKNIKTNVQRNVVNVQYHISKYTAIIGQLRQEVTELRSQLKSKRNMPSMNIE
KYLIVLNTHFQEEAKARKTIQQIEQSVSQLGFVTFSKQVELKSFPENSDAYIHKYNEIET
LRKNVEAHEEQLRIEREKTLDLEKKRLGIENSWAKLGIEEPYLSQLQLEMKKLILSITSL
DMEGKESQAQVVIEQKDQYIKLLEEQLKIRDSILEGNQELIRQSPERVAAAYHNLKSLQE
ISSQSIIMNPSKKRNSYHMGPIENRDYASSLPPISHSRIPRPKVASPTASTKSKESTNLP
SIAKPEHPKDKYKEGRRRRYRHRIRSYSTGSSESDKSYASTYVKSEKKAQVKYALKPDRS
NASPKYRRQTQYKG


>SteCoe_12766(CDS)
ATGCTTAATAAAAAGCCAGTTGAAAAAAGAGATACTGAGCAAGAAGATGTTGACATTCAT
TCTTCAATGCAACAAGGAATGTCTAATATATTAGTGTCTGTAAGAGTAAGGCCATTGTCA
AAAAAGGAACTGGAGGTCGATAGTAGATGTCTAGTGCATACTCTCGATAACAATCTAGTG
GTTTTGCTTGACCCGACAGCAGACATAAACTTACCAGAAGACTCTTTCCGATCAAACCGT
TCCAGAGAAAAGCAATACGCTTTCGACATGGCATTTGACAAATCCTCCACTCAGGAAGCT
ATTTTCGAAAAAACGACAAAATTCCTGATTGATGGTGTAGCAAACGGCTACAACGCAACA
GTCTTTGCATATGGGGCAACTGGAGCAGGAAAAACTCATACTATGATAGGTGATGCAGAC
AAGCCAGGTTTAATGCTTTTAACATTTGAAGACATTTTCGCTTGTCTTGATAGACTTTCT
ATAGAACGTCAATACAAAGTGCGTCTAACTTATCTAGAAATTTATAATGAAGAAGTACGT
GATTTGTTTACAACAAATAGAATTTCTGAAAGTTTAGACATAAGAGAAGATTCTATTAAA
GGAGTAACAGTAGTAGGACTAAGTGAGCTTATGGTGACATCAGCTAAAGAAGTAGTAAAT
CATATCCGCAATGGTAATAAAAGAAGAACTTGTGAGCCGACAATGGCTAATGAGACTTCA
AGTCGTTCACATGCTGTTCTTCAAATAATAGTTGAATATAAAGACAAAGCTTCTGGACTA
GACGCAGATATTATAAGTGGGAAACTAAGTTTAATCGATTTAGCAGGTTCAGAAAGAGCA
TCAACAACAAAAAATCGAGGCATTCGTTTACTAGAAGGGGCGAATATAAATAGATCCTTA
CTCGCTTTAGGCAATTGTATCAATGCTCTATATGAGAACTCTGAAAAAGGGACAAAAATT
TTCATCCCATATAGAGACTCAAAACTCACAAGACTACTTAAAGACTCTTTAGGAGGAAAC
TGTAGAACTGTTATGATAGCATGTGTTTCCCCTAGCTATGGATCATTTGAAGATACCCAT
AACACCCTAACTTATGCTAATCGAGCTAAAAACATTAAAACTAATGTTCAAAGAAATGTT
GTCAATGTTCAGTACCATATTTCTAAATACACTGCTATTATTGGGCAATTAAGACAAGAA
GTGACTGAATTAAGATCACAACTTAAATCTAAAAGAAATATGCCTTCTATGAATATTGAG
AAATATCTAATTGTGTTAAATACGCATTTTCAAGAAGAAGCTAAAGCTAGGAAAACTATA
CAGCAGATTGAGCAGAGTGTTAGTCAATTAGGGTTTGTAACTTTTTCTAAACAAGTTGAA
TTGAAAAGTTTCCCTGAGAACTCAGATGCTTATATTCATAAATATAATGAAATTGAAACT
TTGAGGAAAAATGTTGAGGCACATGAAGAACAGTTGAGGATTGAGAGAGAAAAAACTTTA
GATTTAGAAAAAAAGAGACTTGGGATTGAGAATAGTTGGGCTAAACTTGGTATTGAGGAA
CCTTACTTATCTCAGTTGCAGTTGGAAATGAAAAAACTGATTTTGTCTATAACATCTTTG
GATATGGAAGGTAAGGAAAGCCAAGCACAAGTAGTAATTGAGCAAAAAGACCAATATATA
AAATTACTAGAAGAGCAATTGAAAATACGTGATTCAATATTAGAAGGCAACCAAGAACTA
ATTCGCCAATCTCCAGAAAGAGTGGCTGCAGCATATCATAACCTTAAAAGCTTACAAGAA
ATTTCATCTCAATCCATTATAATGAACCCTAGTAAAAAAAGAAACTCTTATCATATGGGT
CCTATAGAAAATAGAGATTATGCTAGTTCTTTACCACCTATATCTCATTCAAGAATCCCA
AGACCTAAAGTTGCATCACCTACAGCTTCTACTAAATCTAAAGAAAGTACAAACTTACCT
AGTATTGCAAAGCCTGAACATCCAAAGGATAAATATAAAGAAGGTAGAAGAAGAAGGTAT
AGACATAGAATAAGATCATATTCTACAGGATCTAGTGAATCTGATAAAAGCTATGCAAGC
ACTTATGTTAAAAGTGAGAAAAAAGCTCAGGTTAAGTATGCTTTGAAACCTGACAGGAGC
AATGCTAGCCCTAAGTACAGAAGGCAAACTCAGTACAAAGGGTAA