Identifiers and Description

Gene Model Identifier

SteCoe_12774

Standard Name

None

Aliases

None

Description

DNA_ligase_A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17485.0.g1012.194878508014299e-72ATP dependent DNA ligase domai
n

Tetrahymena ThermophilaTTHERM_003870503.1743585474772134e-60DNA ligase required for nonhom
ologous end-joining (NHEJ)


Saccharomyces CerevisiaeYOR005C6.47023492564546e-26DNA ligase required for nonhom
ologous end-joining (NHEJ); fo
rms stable heterodimer with re
quired cofactor Lif1p, interac
ts with Nej1p; involved in mei
osis, not essential for vegeta
tive growth; mutations in huma
n ortholog lead to ligase IV s
yndrome and Dubowitz syndrome
WormBaseWBGene000029852.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12774(Protein)
MDDLDKCSVPFSRLCEFMEKLNRQKGKNKANNLKKFFKSNVKSFFPIIRLMVPSYDMERG
QYGLKETTLGKLYAELLNLPTREKEALVFYKNPNKQFEGCPAGGFVEVLEFILSKRIGAS
KNLSVEEVNALLDKLANAIDKAEKKKVLRELVCSMSSMEQKWLVKIILKDMKLGTHEKIL
GLYHEKALEIYFHTNNLREVFTKLRDKNTDLSSHLYTLGQPIRPMLAGRKPYQELKKLLA
NSEVFVETKFDGERIQCHFTQNDDFFLYSRNAVDYTNMYSKALKDVIINNIKGLRACILD
GELIVWDLENRCQGRFGQNKTVALEETPGKTLCYKVFDILYMETLDGECVDLMPRPIVDR
KALLEKHINPVPNKFEVSKSYQVKGSKAVFDLFNKAIEENEEGLIVKRMDSPYIADDRSN
LWLKLKSEYFEALSDTLDLLIVGGYYGSGFRAGGGDEFDHITVFLCAVANKIDLKDPTRS
KFIPVTKVGTGYSLHELSEIRRGLKDQWKAFRQSPDYWPKWVPGSGERPDYYIKDPSKSI
VLELKAAEIVPTEKFPSEFTLRFPKVHKIRYDKNWDQATTLSEFSGIMDNFSRGLTEKTA
KIEEAHKKDPSKVPRKRKREAQVKGEVLEAFRDTDTQGIIPKSKLFEGFEFFVAKAQDKP
ELEKLIVEYGGNKVQNFLNTTNYVIASDKNSIRIQNLIEKKDINIILPKWVLDCIKYEQI
LDFRPQYICHASSGLKFKFDNEFTKYGNSLNFFHKDQNEVFELAQKVSQYDITIMIKSLK
NPWWSEFPENFIEELRSIPAYAFLGYTFYIPNIGLESELCKTIVLSRNGNLSQIPDENTT
HFLCLVPDYYEEGNWSFIDKETFYALVKS


>SteCoe_12774(CDS)
ATGGACGATTTAGACAAATGCAGTGTGCCTTTTTCACGGTTGTGCGAATTTATGGAGAAA
CTTAATAGACAAAAAGGAAAAAACAAAGCAAACAACCTTAAAAAGTTCTTCAAATCAAAT
GTTAAAAGCTTTTTTCCTATTATCAGACTTATGGTTCCAAGTTATGATATGGAAAGAGGT
CAGTATGGGCTCAAAGAAACAACATTAGGGAAACTATATGCAGAATTGTTAAACCTACCA
ACAAGAGAAAAAGAAGCACTGGTTTTTTATAAAAATCCTAACAAACAGTTTGAAGGATGT
CCAGCTGGTGGGTTTGTGGAAGTTCTGGAATTTATATTGTCAAAAAGAATTGGGGCATCT
AAAAACTTATCTGTTGAAGAAGTTAATGCACTATTAGACAAACTTGCTAATGCTATTGAT
AAAGCTGAGAAAAAAAAAGTTCTCAGAGAATTAGTGTGTTCGATGAGTTCCATGGAACAA
AAGTGGTTAGTAAAAATAATCCTCAAAGACATGAAACTAGGAACTCATGAAAAAATCCTA
GGTCTATACCACGAAAAAGCTTTAGAAATCTACTTCCACACAAACAACCTTCGTGAAGTT
TTTACCAAGCTTCGTGATAAAAACACAGACCTCTCAAGTCATTTATACACTTTAGGTCAG
CCAATAAGACCAATGTTAGCAGGACGAAAGCCATATCAAGAGTTAAAAAAACTATTAGCA
AATTCTGAAGTTTTTGTTGAAACCAAATTTGATGGAGAAAGAATACAATGTCATTTTACT
CAAAATGATGACTTTTTTTTATATAGTCGAAATGCTGTAGATTATACAAACATGTATAGC
AAAGCTTTAAAAGATGTTATAATTAACAATATAAAAGGACTTAGAGCATGTATTTTAGAT
GGAGAACTTATTGTATGGGATTTAGAAAATAGATGCCAAGGCCGGTTTGGGCAGAATAAA
ACTGTTGCATTAGAAGAAACTCCAGGTAAAACATTATGTTATAAGGTTTTTGATATTTTA
TATATGGAAACTTTAGATGGAGAATGTGTAGATTTAATGCCAAGACCGATTGTGGATAGA
AAAGCTTTATTAGAAAAACACATAAATCCTGTGCCGAATAAATTTGAAGTTTCTAAAAGT
TATCAAGTCAAAGGTTCAAAAGCTGTATTTGATTTGTTTAATAAAGCAATAGAGGAAAAT
GAAGAAGGATTGATTGTTAAAAGGATGGACTCGCCGTATATTGCGGATGATAGGAGTAAT
TTATGGCTTAAGCTTAAAAGTGAATATTTTGAAGCGTTGAGTGATACATTAGATTTGCTT
ATTGTTGGAGGATATTATGGATCAGGGTTTAGAGCTGGTGGAGGTGATGAATTTGATCAT
ATAACAGTATTTTTATGTGCTGTTGCTAATAAAATTGATCTTAAAGACCCTACTAGAAGT
AAATTTATCCCAGTAACTAAAGTTGGGACTGGATATAGCTTGCATGAACTTTCGGAAATA
CGTCGAGGGCTTAAGGATCAGTGGAAAGCTTTTAGACAATCTCCTGATTACTGGCCTAAA
TGGGTTCCTGGATCTGGTGAAAGACCTGATTATTATATTAAAGATCCATCTAAGTCGATT
GTCCTTGAACTTAAAGCTGCAGAAATTGTCCCAACTGAAAAGTTTCCAAGCGAATTTACA
TTGAGATTCCCTAAGGTACATAAAATTAGATATGATAAAAACTGGGATCAAGCAACAACT
TTGAGTGAGTTTAGTGGGATTATGGATAATTTTTCAAGAGGACTTACTGAAAAAACAGCA
AAAATCGAAGAAGCTCATAAAAAAGATCCTTCTAAAGTACCAAGAAAACGGAAAAGAGAA
GCACAGGTAAAAGGGGAAGTACTTGAAGCATTTAGAGATACTGATACACAAGGTATAATT
CCAAAATCAAAATTATTTGAAGGGTTTGAGTTTTTTGTTGCTAAAGCTCAAGACAAACCT
GAACTAGAAAAATTGATAGTAGAATATGGGGGGAATAAAGTACAGAACTTTCTTAATACA
ACTAATTATGTTATAGCAAGTGATAAAAATTCTATCCGTATTCAGAATCTGATAGAAAAA
AAGGATATAAATATAATATTACCTAAATGGGTGTTGGATTGTATTAAGTATGAACAAATA
TTAGATTTCAGGCCACAGTATATATGCCATGCAAGTTCTGGATTAAAGTTCAAGTTCGAT
AATGAGTTTACAAAATATGGCAACAGCTTGAATTTCTTCCACAAAGATCAGAATGAAGTT
TTTGAACTCGCTCAAAAAGTTTCTCAATATGATATCACTATTATGATAAAATCATTAAAA
AACCCTTGGTGGAGTGAATTTCCTGAAAATTTTATTGAGGAATTACGATCAATCCCAGCT
TATGCTTTTCTTGGATATACATTTTATATACCAAATATTGGCCTTGAGTCTGAACTTTGT
AAGACTATTGTATTAAGTCGTAATGGAAACCTTTCGCAAATCCCTGATGAAAATACAACA
CATTTCTTGTGCCTTGTCCCGGATTATTATGAAGAAGGAAATTGGAGTTTTATAGATAAA
GAAACATTTTATGCTTTAGTTAAATCCTAA