Identifiers and Description

Gene Model Identifier

SteCoe_12813

Standard Name

None

Aliases

None

Description

SWIRM domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005848401.4251640827409352e-21SWIRM domain containing protei
n
Oxytricha TrifallaxContig19570.0.g371.4251640827409352e-21SWIRM domain

WormBaseWBGene000042032.3195228302435696e-16
Saccharomyces CerevisiaeYFR037C0.0000000000006914400106940203Component of the RSC chromatin
remodeling complex; essential
for viability and mitotic gro
wth; homolog of SWI/SNF subuni
t Swi3p, but unlike Swi3p, doe
s not activate transcription o
f reporters

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12813(Protein)
MDIIVTLQKEDEGFVVVQESGYTLNFPYVPFYRTLTPAVIPSCASWFDPLAIHQVEVDSL
PEYFNGNYPSKTPSVYMTYRNFIIKLYRDKPTCYLTATQCRRVLTGDACSIIRLHAFLEH
WGIINLYAEKPYTHPSYDFAWPGHMSYGRKRLFELGRPFCGCCGNICGVTWMDDSKLTLC
ADCFEKGNFADPINLTEFNQENLLSHFKYSELFKGEDWDEQQTSELIKALKKHGEDWDLV
AEEVGKDKNQVIFKYLSIPVQDLIEAENEKFIDYENPLHPEMKTVGEKIDMDEAMENAKI
ARKNEEIEIDRILNEMIEIQCKKIEIKSKYISEMKNLLDMQTTNVKSRIQNLVNLHTILS
MSKNNE


>SteCoe_12813(CDS)
ATGGACATCATAGTAACTCTGCAAAAAGAAGACGAGGGGTTTGTTGTAGTCCAAGAGTCT
GGTTACACCTTAAACTTCCCTTACGTTCCATTTTACCGAACCCTTACCCCTGCCGTAATT
CCAAGTTGCGCCTCTTGGTTTGACCCTTTAGCAATCCATCAAGTAGAAGTTGATTCATTA
CCTGAATACTTTAATGGAAACTACCCATCAAAAACCCCATCAGTATATATGACATATAGA
AACTTTATAATCAAACTTTATCGAGATAAACCAACCTGTTATCTTACCGCAACACAATGT
CGAAGAGTTCTTACTGGTGATGCATGTTCAATTATCCGCCTTCATGCCTTTTTAGAACAT
TGGGGAATCATAAATTTATATGCAGAAAAACCTTATACTCATCCTTCTTATGATTTCGCT
TGGCCTGGGCATATGAGTTATGGTCGTAAAAGGCTTTTTGAACTAGGCAGACCTTTCTGT
GGATGCTGTGGAAATATCTGTGGGGTTACTTGGATGGATGATTCAAAACTTACTCTTTGT
GCTGATTGTTTTGAAAAAGGAAATTTCGCTGATCCTATTAACTTAACAGAATTTAATCAA
GAAAATCTTTTATCGCATTTTAAATATTCAGAACTTTTCAAAGGGGAAGATTGGGATGAA
CAACAGACAAGTGAATTGATAAAAGCTTTAAAAAAACATGGAGAAGACTGGGATTTAGTT
GCTGAAGAAGTTGGAAAAGATAAAAATCAAGTGATTTTTAAGTATTTGAGTATACCAGTA
CAGGATTTAATTGAAGCTGAAAATGAGAAGTTTATTGATTATGAAAACCCTTTACACCCT
GAGATGAAGACTGTTGGGGAAAAAATTGATATGGATGAAGCTATGGAGAATGCGAAGATT
GCTAGGAAAAATGAAGAGATTGAAATTGATAGGATATTAAATGAGATGATAGAAATACAG
TGCAAAAAAATCGAGATTAAAAGTAAGTATATTTCAGAGATGAAAAATTTATTGGATATG
CAGACTACTAATGTAAAATCAAGGATACAGAATTTGGTAAACCTGCACACAATACTTTCT
ATGTCTAAAAATAATGAATGA