Identifiers and Description

Gene Model Identifier

SteCoe_1293

Standard Name

None

Aliases

None

Description

Ku_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17155.0.g651.4043787324419038e-54Ku70/Ku80 beta-barrel domain

Tetrahymena ThermophilaTTHERM_005617991.6889118802245324e-48homolog to human KU70 DNA heli
case and yeast YKU70
WormBaseWBGene000005190.0009118819655545162

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1293(Protein)
MDFEEGEDLFLGEDEEQGPQDYLPQKDEVIMLIDCSASMMLAHNNGDIPFFMVIKAALGF
LKSRILSSETDSIAIILYNTKAKKNHMELENIYVLQDLASPDAQRIKELQTLLDQGWHPY
GHGEALLVNALWVCHDILAQNKNSANRRILLFTDEDRPNANHPREIDIAVQRAKDLAQQD
ISLELYPLNKPDKAFNFQAFYIRVIPVDEDESIENINGLEKLEDLICKMHTKEYKKRKLG
TINFALCPNMFIAMNYYCVFRESKKPTPSKLHAKDNKKLKSVTSWICQESGKQLWSHNVG
NHYEMGGSKVKFNKEEVAHIKNFDAPGLKLMGFKNRDRIKNYMNVRASYFLYPEENRVKG
SSQVVNSLLTSMIKLNKIAIVRFIPRQGAVVRFGALVPSQEPKGFNLIFMPYADDMRNPE
TLKAKGEVQKAPEDMVKSAAAMIGNIQLGDFDVKSYYNPVLQHFYTNLEALALEEPKPPQ
IQDSLEPDEEGMQKKEQYIKEFWELAYNGNAKRQTKNDIGDGKKKKGDTYTEGELKKMKV
PELKEICDRLGIAKAGRKDDLIERILGKM


>SteCoe_1293(CDS)
ATGGACTTTGAAGAAGGTGAAGATCTTTTCCTTGGTGAAGATGAGGAACAAGGTCCCCAA
GACTATCTCCCACAAAAAGATGAAGTTATTATGCTTATAGACTGTAGTGCAAGTATGATG
CTTGCCCACAACAATGGTGATATCCCTTTTTTCATGGTAATCAAAGCCGCTTTAGGATTC
CTAAAATCTAGAATCCTGAGTTCAGAAACTGACAGTATAGCAATAATTCTCTACAACACT
AAGGCTAAAAAAAACCATATGGAATTAGAAAATATTTATGTTCTTCAAGATCTTGCTTCA
CCAGATGCTCAAAGAATCAAAGAATTACAGACTCTCTTAGATCAGGGTTGGCATCCATAT
GGTCATGGTGAAGCTCTTCTTGTAAACGCTTTATGGGTATGTCATGATATTTTAGCTCAA
AACAAAAACTCAGCAAATAGGCGAATTCTGCTCTTTACCGATGAAGATAGACCAAATGCA
AATCATCCTCGGGAAATCGATATTGCCGTACAAAGGGCAAAAGATTTAGCTCAACAAGAT
ATAAGCTTAGAACTTTACCCTTTAAATAAACCAGATAAAGCTTTTAACTTCCAAGCTTTT
TATATAAGAGTCATCCCAGTTGATGAAGATGAATCTATAGAAAATATTAATGGTCTTGAA
AAACTTGAAGACTTAATATGTAAAATGCATACTAAAGAGTATAAAAAACGCAAACTTGGG
ACTATCAACTTTGCCTTATGCCCTAACATGTTTATTGCTATGAATTATTACTGTGTTTTT
AGAGAAAGTAAAAAGCCAACTCCTTCTAAACTTCATGCAAAAGATAACAAAAAACTCAAA
TCTGTTACTAGTTGGATATGCCAAGAAAGTGGTAAACAACTTTGGTCACATAATGTTGGT
AATCATTATGAAATGGGAGGAAGTAAAGTCAAATTTAATAAAGAAGAAGTTGCTCATATA
AAGAATTTTGATGCTCCTGGACTTAAACTTATGGGTTTTAAAAATCGAGATAGGATAAAA
AATTATATGAATGTAAGGGCAAGTTATTTTTTATATCCTGAAGAAAATAGGGTTAAAGGA
AGTTCACAGGTTGTAAATTCATTATTGACTTCTATGATTAAGCTAAATAAAATTGCTATT
GTTAGGTTTATACCAAGACAAGGTGCTGTTGTTAGGTTTGGAGCTTTAGTACCAAGTCAA
GAACCTAAAGGATTTAATTTGATTTTTATGCCTTATGCTGATGATATGAGGAATCCGGAA
ACACTTAAAGCTAAAGGAGAGGTACAAAAAGCTCCTGAGGATATGGTTAAAAGTGCTGCG
GCTATGATTGGAAATATACAATTAGGAGACTTTGATGTAAAGTCGTATTATAATCCAGTA
TTACAGCATTTTTATACTAATCTTGAAGCTTTGGCTTTGGAAGAACCTAAACCTCCACAA
ATACAGGACTCGTTGGAACCAGATGAAGAAGGAATGCAGAAAAAGGAACAGTATATAAAA
GAGTTTTGGGAGTTGGCGTATAATGGAAATGCAAAGAGGCAAACAAAAAATGATATTGGT
GATGGCAAAAAGAAAAAAGGAGATACTTATACGGAAGGTGAACTTAAGAAAATGAAGGTT
CCTGAGCTTAAAGAAATTTGTGATCGGTTGGGCATAGCTAAAGCTGGAAGAAAAGATGAT
CTTATTGAGAGAATATTAGGCAAGATGTAG