Identifiers and Description

Gene Model Identifier

SteCoe_12930

Standard Name

None

Aliases

None

Description

HHH_5 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20641.0.0.g164.834541638053336e-68Rad51

Tetrahymena ThermophilaTTHERM_001423303.5722699376192174e-67DNA repair protein RAD51 conta
ining protein; Strand exchange
protein; involved in homologo
us recombination and repair of
double-stranded DNA breaks
WormBaseWBGene000042972.3455513385429143e-59
Saccharomyces CerevisiaeYER095W1.2806276389220833e-57Strand exchange protein; forms
a helical filament with DNA t
hat searches for homology; inv
olved in the recombinational r
epair of double-strand breaks
in DNA during vegetative growt
h and meiosis; homolog of Dmc1
p and bacterial RecA protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_12930(Protein)
MLAARDLNRQDNNIETGPMSLQKLKEHGITQSDISKLQEAGFHSIESIAMATKKTISAVK
GISDNKADKLLELCHKFFPMGFITATAVHEERKQLVYLTTGSSALDKLLGGGIESGSLTE
IFGEFRTGKTQICHTLAVTAQLPYSMGGGEGKVIYIDTEGTFRPERIISIANRFGLDPKT
TLDNIGVARAYNSDHQMQLLIQATAIMSESRYALLIIDSATALYRTDYIGRGELASRQNS
LGKFLRGLQRLADEYSIAVVYTNQVVAQVDGGSVFIADAKKPIGGHIMAHASTIRLSLRK
GRGESRAMKVYDAPNLPEAEAFYVIDEGGIIDSSDS


>SteCoe_12930(CDS)
ATGTTAGCAGCGCGGGATCTAAATCGTCAAGACAACAACATAGAAACCGGGCCAATGTCA
CTACAAAAACTTAAAGAGCACGGGATAACCCAATCAGATATCTCCAAGCTCCAAGAAGCA
GGTTTTCACTCAATTGAATCAATAGCAATGGCAACAAAAAAAACAATATCCGCGGTAAAA
GGTATTTCCGATAACAAAGCCGACAAGCTTCTAGAATTATGTCACAAATTCTTCCCAATG
GGTTTTATAACAGCAACCGCAGTCCACGAAGAAAGAAAACAATTAGTTTACTTAACAACA
GGTTCATCTGCATTAGATAAACTCTTAGGTGGGGGTATAGAATCAGGATCATTAACAGAA
ATCTTTGGAGAATTCAGAACAGGAAAAACACAAATTTGTCATACTTTAGCTGTAACAGCT
CAATTACCTTATTCTATGGGAGGTGGTGAAGGTAAAGTTATTTATATCGATACCGAAGGG
ACTTTTAGACCTGAAAGAATTATTTCTATTGCAAACAGATTTGGACTTGATCCTAAGACT
ACATTAGATAATATTGGTGTTGCTAGAGCTTATAATTCAGATCATCAAATGCAATTATTA
ATACAAGCTACTGCTATTATGTCTGAAAGTCGATATGCATTACTTATAATTGATTCAGCT
ACAGCTTTATATAGGACTGATTATATTGGAAGAGGAGAGTTAGCATCTAGACAAAATAGT
TTAGGGAAATTCTTGCGAGGTTTACAGAGACTCGCAGATGAATATTCTATAGCAGTTGTT
TATACAAATCAAGTTGTAGCACAAGTTGATGGAGGTTCAGTATTTATTGCTGATGCTAAA
AAACCTATTGGCGGGCATATCATGGCTCATGCATCAACAATCCGTTTATCTTTACGTAAA
GGTAGAGGGGAAAGTCGAGCAATGAAAGTTTACGACGCACCAAATTTACCTGAAGCAGAA
GCTTTTTATGTTATAGATGAAGGTGGAATTATAGATTCTTCAGACTCTTAA