Identifiers and Description

Gene Model Identifier

SteCoe_13018

Standard Name

None

Aliases

None

Description

AAA domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12666.0.1.g290ATPase family associated with
various cellular activities (A
AA)

WormBaseWBGene000045030

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13018(Protein)
MAAVEVQHSMEIDNESEDLYKRMKQLERENEFYDIQSEYIKDELKNLKREFIRAREEIKR
IQSVPLVIGQFLELVDENYAIVSSTAGSNYYVRVLSTLNRELLKPSSSIALHRHSHSVVD
ILPNETDASIQLMQMGEKPEVTYQDVGGLDIQKQEIREAVELPLTNHELYAQIGIDPPRG
VLLYGPPGTGKTMLAKAVANNTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLARENAPAI
VFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQSVNVKVIMATNRADTLDAAL
MRPGRLDRKIEFPMPDRRQKRLIFQTVTNKMNLSEEVDLEDYINRPEKISAADISAICQE
AGLLAVRRNRYVILPKDFERAYKNVVKKSDTEFEFYK


>SteCoe_13018(CDS)
ATGGCTGCAGTAGAAGTTCAGCATTCAATGGAAATCGATAACGAGAGCGAAGATCTCTAC
AAGCGTATGAAACAACTTGAGCGCGAAAACGAATTCTACGACATCCAAAGTGAGTATATC
AAAGATGAGCTCAAAAATTTGAAGCGTGAGTTCATTCGAGCCAGAGAAGAAATCAAACGC
ATTCAATCTGTTCCCCTAGTGATAGGCCAATTTCTCGAGTTGGTAGATGAGAATTATGCA
ATAGTTTCAAGCACAGCTGGTTCAAATTACTACGTGCGGGTTCTTTCCACACTAAACCGA
GAGCTCTTAAAGCCTTCTTCTTCTATAGCCTTGCATCGTCATTCTCATAGTGTTGTAGAT
ATTCTTCCAAACGAAACTGATGCCTCTATTCAACTAATGCAGATGGGGGAAAAACCAGAA
GTGACTTATCAAGATGTTGGTGGTCTTGACATTCAAAAACAAGAAATCCGTGAGGCTGTT
GAACTGCCACTAACCAACCATGAGCTTTATGCTCAAATCGGCATTGACCCACCTAGAGGT
GTCTTGCTTTATGGACCTCCAGGGACTGGGAAGACAATGCTTGCTAAGGCTGTTGCTAAT
AACACGACTGCAGCTTTTATTAGAGTTGTTGGTTCTGAGTTCGTTCAGAAATATTTAGGA
GAAGGCCCTAGAATGGTTCGTGATGTTTTTAGATTGGCCAGAGAAAATGCCCCAGCTATT
GTGTTTATTGATGAGATCGATGCTATTGCAACAAAAAGGTTTGACGCACAAACTGGAGCT
GATCGTGAAGTTCAAAGGATTTTATTGGAGCTACTCAATCAAATGGACGGATTCGATCAA
AGTGTCAATGTTAAGGTAATTATGGCCACAAATAGAGCTGATACTTTGGATGCAGCCCTA
ATGAGACCTGGAAGACTGGATAGAAAGATTGAATTCCCTATGCCTGATAGGAGACAGAAA
AGGCTGATTTTCCAGACGGTCACAAATAAAATGAACTTATCTGAGGAAGTCGATTTAGAA
GACTATATCAACAGACCTGAAAAAATCAGCGCGGCCGACATTTCTGCAATTTGTCAGGAA
GCTGGCTTGCTGGCTGTAAGGAGAAACAGGTATGTCATACTGCCAAAAGACTTTGAAAGA
GCTTATAAAAATGTAGTCAAGAAAAGCGATACAGAATTTGAATTCTATAAGTAG