Identifiers and Description

Gene Model Identifier

SteCoe_1302

Standard Name

None

Aliases

None

Description

PGI domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18210.0.g670Phosphoglucose isomerase

Saccharomyces CerevisiaeYBR196C2.0842828425817514e-52Glycolytic enzyme phosphogluco
se isomerase; catalyzes the in
terconversion of glucose-6-pho
sphate and fructose-6-phosphat
e; required for cell cycle pro
gression and completion of the
gluconeogenic events of sporu
lation
WormBaseWBGene000135974.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1302(Protein)
MEVLTKLRHHANQIKAHHLRDLLSDSSRNTHANFESILLDFSHSKVTNETLELLSEYAES
SNLFTKIAGLYSGEVINPTEGRSVLHTLLRAETSDLPIFGEVVDVRNRIKDFSSKVRNGE
FVGVSGKPLVDTLCIGIGGSYLGPEFVAEALKTEPECARAAAGRKLRFLANVDPVDFIRN
TSDLDPHTTLVIVISKTFTTAETMMNAKTVKEWMVKSLGEFPADEVVKKHIVAVSTNIPK
TSEFGISVENVFGFWDWVGGRFSVTSAVGLLPLYLQYGENVTNFLKGANSVDKMFLEKAN
RGGLSQNLPLLLGIIGWWNTEFLEYSSRAILPYSQALVRFAAHIQQVDMESNGKQCSLTG
EPVKTTGPLVFGEPGTNGQHSFYQLMHQGRIVPAEFIGFCKSHSTDTLAHNELMSNFFAQ
PDALALGKTDYQLGTEKCPDHLIPHKRFPGDRPSLSILIENLNSYTCGQLLALYEHRVAV
EGFLWGINSFDQFGVELGKGLATQVKKTIETGNFDEHPSKRLLEFYVAHRNN


>SteCoe_1302(CDS)
ATGGAAGTCCTTACCAAACTTCGTCATCACGCAAATCAAATCAAAGCCCATCATCTCAGA
GACCTTCTTAGCGACAGTTCTCGTAATACCCATGCCAATTTCGAAAGTATTCTTCTAGAC
TTCTCACATAGTAAAGTTACTAATGAAACTTTAGAACTTCTTTCTGAATATGCTGAGTCA
AGCAATCTTTTCACAAAAATCGCTGGGCTTTACTCAGGAGAGGTAATAAATCCTACTGAA
GGGAGGTCTGTGCTTCATACTTTATTAAGAGCTGAAACTTCTGATTTGCCTATTTTTGGT
GAAGTTGTTGATGTGAGGAACAGAATCAAAGATTTCAGTTCAAAAGTCAGAAATGGGGAA
TTTGTTGGAGTTTCAGGCAAACCATTAGTTGATACTTTATGTATTGGAATTGGAGGTAGC
TATCTTGGACCAGAATTTGTTGCTGAAGCACTTAAGACTGAACCTGAATGCGCAAGAGCT
GCTGCTGGAAGAAAGCTTAGATTTTTAGCTAATGTTGACCCTGTAGACTTTATAAGAAAT
ACTAGTGATTTAGATCCACATACAACTTTGGTTATTGTTATTTCTAAAACTTTTACAACT
GCTGAGACTATGATGAATGCTAAAACTGTTAAAGAATGGATGGTAAAAAGTTTAGGTGAA
TTCCCAGCTGATGAAGTTGTAAAAAAACATATAGTTGCAGTATCGACGAATATACCTAAA
ACATCTGAATTTGGTATAAGTGTTGAAAATGTTTTTGGGTTCTGGGATTGGGTTGGAGGA
CGTTTTTCTGTGACTTCAGCTGTTGGACTTTTACCACTTTATCTTCAGTATGGGGAAAAT
GTTACTAATTTCCTTAAAGGGGCTAATTCGGTTGATAAGATGTTTTTAGAAAAAGCTAAT
AGAGGAGGATTAAGTCAGAATCTACCTCTTTTGTTAGGGATTATTGGGTGGTGGAATACT
GAGTTCCTTGAGTACTCGTCAAGAGCTATTCTCCCGTATAGCCAAGCTCTTGTGAGGTTT
GCAGCTCATATACAGCAGGTTGATATGGAAAGCAACGGCAAACAGTGTAGCCTTACTGGA
GAGCCTGTAAAAACAACAGGTCCTCTAGTTTTTGGTGAGCCAGGAACCAACGGCCAGCAC
TCTTTTTACCAGTTAATGCATCAAGGCCGAATAGTTCCAGCTGAATTTATTGGTTTCTGT
AAATCTCACAGCACAGATACCCTTGCCCACAACGAACTCATGAGCAACTTTTTCGCTCAA
CCTGATGCTTTAGCTTTAGGTAAAACTGATTATCAGCTCGGAACTGAAAAATGTCCTGAT
CATCTTATCCCTCATAAAAGATTCCCTGGAGATAGACCAAGTCTAAGTATTCTTATAGAA
AATCTCAATTCTTATACTTGTGGTCAATTATTAGCTTTATATGAACATCGTGTAGCTGTT
GAAGGGTTTTTATGGGGAATAAACAGTTTTGATCAATTCGGTGTTGAACTCGGAAAAGGA
CTTGCCACACAAGTCAAAAAAACTATTGAAACTGGGAATTTTGATGAACATCCAAGTAAA
AGATTATTAGAATTTTATGTTGCCCATAGGAATAATTAA