Identifiers and Description

Gene Model Identifier

SteCoe_13025

Standard Name

None

Aliases

None

Description

WASH-7_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11125.0.g671.4788975056432133e-74hypothetical protein

WormBaseWBGene000131673.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13025(Protein)
MEPYYSDDETGELVSNAPTYSRPAYEFQMSKLRELVTLYKEKLNDVEKIRTEQPCHPRAM
AVEYQSYERAVGILELVTTSNQDLNKVLTVFTYLISEIKIAREYIDCNVVIGLNFYGEGK
MQADQMPEGEAELMMGQMMPFFSEVFESLSYVNSLVVNLVTQLHSLYYKKQPKNHDLYGN
LFKYVHLNSAFDALGKMLGGLAMIDSVVDDNQNLVNHWDLYKRMMQFAKNDPAKYGITDK
LERQLRKCLLFLDKSILSGNCLQACLSHKGYEAAISSNKELQNEFLNYFKVKIDKLTNSI
ESQYEWQESKIVVDVICLYFLYRKLYPKDFDKKLFKSVWSLIKKAPVVCVTGQVIIYPHE
LIMKIAPAPKSVAVEPKDPEQYIRAYMQKSDDNLDKSMQTWLSKFSLWSSRMQSFLNSST
SLPETQVQKLQDSRGKLLLQGLLLAYQIQNYIQVNTALHERNGVPFKANFIPLLMQAIEL
IKAINSTLERKQEIIALYLGSIIRLIFKDAIKPYDMIRDKLGAKPSGVGLDIISIYKLVN
ELGSGCLNSIRSDLLKLCNEIVDIKSILKENEKSLVEDGLWKFEILVEYQSNLKNSTDCS
FIYWIQQLNTHFLKYIYDEPANVHRLRYLYMALEDSAKQMLLCRHVEDANDIKQNYIKDR
ENELVEMVIMPLARAIESDLRLHIHSLYITGIEKQNPFQSSNLSWFLDSQPMVFCEKVID
IKRKIEMYLDETFYNMTALNLNDWRTYEEMRSLARQKYKLNLSEVHLPSKHLDQGMDLLD
ITKKLPNFVNKFKYNLHSQFFIEATEGDEKHVALVSYMHITNSLRTHGLGLINTTINTSY
RLLAKKFQIFSQFLYDDHVYSQLVKDRKFFENNREALNQMYSYDRAENFLREVKKLGVFD
KNLTLIDKFRILITQIGNTLGLIRMIKTAGLNLTATRTQFIPNTQNIPNITELAEKFSDG
TKSAASSLEDIMESLTKNFTADTDYFKILVTTFQGVLNTNEASHLKLFHMIIPTLTISYV
ESMLTAKDKLTKKKAVDMYFTDDGFAVGLAYILRILEQESLFDSLHWFDSVETKFAQEEE
KLTVIKASEEMQKMQNMSLKKISVFRVEFELLKYCFLGARIFFSNT


>SteCoe_13025(CDS)
ATGGAGCCATATTACAGCGACGATGAAACAGGAGAGCTAGTATCAAATGCTCCAACTTAC
AGCCGGCCAGCCTATGAGTTCCAAATGTCCAAACTCCGGGAGTTAGTCACTCTTTATAAA
GAAAAGCTAAATGACGTAGAGAAAATCCGAACTGAACAGCCTTGCCACCCAAGAGCAATG
GCCGTCGAATACCAGAGCTACGAGCGTGCAGTGGGGATCCTCGAACTTGTAACAACATCA
AACCAAGACCTAAACAAAGTCCTCACAGTGTTCACTTATTTGATTTCTGAGATAAAAATC
GCAAGAGAGTATATCGATTGCAACGTAGTGATTGGGCTGAATTTCTACGGTGAAGGAAAA
ATGCAGGCGGACCAAATGCCTGAAGGAGAGGCTGAGCTGATGATGGGCCAGATGATGCCT
TTTTTCTCGGAAGTCTTTGAGAGTTTGAGCTATGTTAACAGTCTTGTTGTAAATTTGGTC
ACTCAGCTTCATTCTTTATACTACAAAAAGCAACCAAAAAATCATGACTTGTATGGGAAT
TTGTTTAAGTATGTGCATTTAAACAGTGCTTTTGATGCTTTGGGCAAAATGCTTGGAGGC
CTGGCCATGATAGACTCAGTGGTTGATGATAACCAGAATCTTGTTAACCACTGGGATTTG
TATAAACGGATGATGCAATTCGCAAAAAACGACCCTGCTAAATATGGGATTACAGATAAA
CTAGAAAGACAGCTGAGGAAATGCTTGCTTTTCTTAGACAAGTCAATACTAAGTGGAAAT
TGCCTTCAAGCCTGTCTTTCGCATAAAGGATATGAAGCTGCGATTTCTTCTAATAAAGAG
CTTCAGAATGAATTTTTGAACTATTTTAAGGTAAAAATAGATAAGCTGACGAATAGCATT
GAAAGCCAGTATGAGTGGCAGGAATCGAAAATTGTTGTGGATGTCATTTGCTTGTATTTC
TTGTACAGGAAATTGTATCCAAAGGATTTTGATAAGAAACTGTTTAAGTCTGTGTGGAGT
TTGATTAAAAAAGCTCCAGTAGTTTGCGTGACTGGACAAGTTATTATTTACCCTCATGAA
CTAATTATGAAGATTGCCCCTGCACCTAAGAGCGTTGCTGTCGAGCCTAAGGATCCAGAG
CAGTATATCAGGGCATATATGCAAAAGTCCGACGATAACCTTGATAAGTCTATGCAAACC
TGGCTAAGCAAATTTTCCTTGTGGTCTTCAAGGATGCAGAGCTTCCTTAACTCCTCTACA
TCCCTTCCAGAAACTCAGGTCCAAAAGCTCCAAGATAGTCGTGGGAAACTTCTTCTACAA
GGTCTTCTCTTAGCATATCAAATTCAAAACTACATCCAAGTTAATACTGCTTTGCATGAG
CGTAATGGTGTTCCTTTTAAAGCTAATTTTATACCTCTACTAATGCAAGCAATTGAACTA
ATCAAAGCTATAAACTCAACACTAGAAAGGAAACAAGAAATCATAGCTTTATATCTAGGA
TCAATAATCAGGCTTATATTTAAAGATGCAATCAAACCTTATGACATGATCAGAGATAAG
CTTGGAGCTAAGCCAAGTGGAGTAGGTCTGGATATTATAAGCATATACAAATTGGTTAAT
GAGCTAGGGAGTGGATGTCTAAACTCAATAAGATCAGACCTTTTGAAGTTATGTAACGAA
ATTGTTGATATTAAAAGCATACTTAAAGAAAATGAAAAATCATTAGTTGAAGACGGACTT
TGGAAATTTGAAATACTAGTTGAATACCAGAGTAACCTTAAAAACTCGACTGATTGTTCA
TTTATTTATTGGATCCAACAATTAAACACGCATTTCCTTAAATACATTTACGATGAGCCT
GCTAATGTTCATAGGCTAAGGTACTTGTATATGGCTCTTGAAGATTCTGCTAAGCAAATG
CTCTTGTGCCGCCATGTAGAAGATGCCAATGACATTAAACAAAATTACATCAAAGATAGA
GAAAATGAACTTGTCGAGATGGTCATCATGCCATTGGCCCGTGCTATAGAAAGTGATCTT
CGTCTGCACATCCACAGTTTGTACATAACAGGTATAGAAAAACAAAATCCTTTTCAGTCT
AGTAATCTATCTTGGTTCCTAGATAGTCAGCCAATGGTATTTTGTGAGAAGGTCATTGAC
ATTAAAAGGAAAATTGAAATGTACTTGGACGAAACTTTTTACAATATGACTGCACTCAAT
CTTAATGACTGGAGAACTTATGAAGAAATGCGTTCATTAGCCAGACAGAAATATAAACTA
AATCTCAGTGAAGTGCATCTGCCTAGTAAGCATCTTGACCAAGGCATGGATTTACTAGAC
ATTACAAAGAAACTCCCTAACTTTGTCAACAAATTCAAGTACAACTTGCACAGTCAATTT
TTCATTGAAGCTACAGAAGGAGATGAAAAACATGTTGCTCTGGTCTCATACATGCATATA
ACAAATTCACTAAGAACGCATGGTCTTGGTCTTATTAATACAACAATCAATACTTCTTAC
AGGCTTTTGGCAAAGAAGTTCCAGATTTTCTCTCAGTTCTTATATGATGACCACGTTTAT
TCACAGCTTGTCAAGGATAGGAAGTTTTTTGAAAACAACCGAGAAGCTCTTAACCAGATG
TACTCATACGACAGGGCTGAGAACTTTTTGAGAGAAGTCAAAAAACTCGGGGTATTCGAT
AAAAACCTCACTTTAATTGACAAATTCAGAATACTCATAACACAGATTGGGAATACCTTG
GGACTTATTAGAATGATCAAAACCGCAGGACTCAACCTCACAGCTACAAGAACTCAATTT
ATTCCTAACACCCAAAACATTCCCAATATCACGGAACTTGCCGAGAAATTCTCTGATGGG
ACAAAGTCTGCAGCATCTTCACTTGAAGATATTATGGAGTCGCTTACCAAGAATTTTACA
GCCGACACGGATTATTTCAAGATTTTAGTTACAACTTTTCAAGGAGTGCTAAATACAAAC
GAAGCAAGTCATTTGAAACTCTTCCATATGATTATCCCAACACTGACTATCAGTTATGTT
GAAAGCATGCTAACAGCTAAAGACAAGCTCACTAAGAAAAAAGCGGTAGATATGTACTTC
ACTGATGATGGCTTTGCTGTAGGCCTGGCATATATTCTTAGAATTTTAGAACAAGAATCG
CTTTTTGACTCACTTCATTGGTTTGACAGTGTTGAGACAAAGTTTGCCCAAGAAGAAGAA
AAACTCACTGTGATCAAAGCGAGTGAAGAAATGCAGAAAATGCAAAATATGAGTCTAAAG
AAAATCTCAGTGTTCAGAGTTGAGTTTGAATTACTCAAATATTGCTTTTTAGGAGCTAGA
ATTTTCTTTAGTAATACTTAG