Identifiers and Description

Gene Model Identifier

SteCoe_13038

Standard Name

None

Aliases

None

Description

Acetyltransf_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006861400.00000000000003442477108469977acetyltransferase, GNAT family
protein
Oxytricha TrifallaxContig1188.1.g660.0000000000006914400106940203Peptidase family M3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13038(Protein)
MEPLTLTYGPISEKNLKQFKKINEATLAVDYSEKFYAAITSQWQEFTFFAYITDLTIGSL
SARREMRGEEQCIYIMTCSVLEPYRKLNVGKMMIDKLMEKARNSGIKTIYLHVWTASPNA
YQFYTRLGFDKAEEIPDYYQELTPQSAYILTKAVN


>SteCoe_13038(CDS)
ATGGAACCACTGACTTTGACCTATGGCCCAATATCAGAGAAGAACTTGAAGCAATTCAAG
AAAATCAACGAAGCCACTTTGGCTGTAGACTACAGCGAAAAGTTTTATGCTGCCATTACA
TCTCAGTGGCAGGAGTTTACTTTTTTCGCCTATATCACAGATCTTACAATAGGCAGTCTT
AGTGCTAGACGTGAAATGAGAGGTGAAGAGCAGTGTATTTACATAATGACTTGTAGTGTT
CTTGAACCTTATAGAAAATTGAATGTAGGCAAGATGATGATAGATAAGCTTATGGAAAAA
GCTCGGAATAGTGGTATTAAGACAATTTACTTACATGTTTGGACTGCTAGTCCGAATGCG
TATCAGTTTTATACTAGGCTTGGTTTTGATAAAGCTGAGGAGATACCAGATTATTATCAA
GAACTTACCCCTCAGTCAGCTTATATACTAACAAAAGCTGTTAATTAG