Identifiers and Description

Gene Model Identifier

SteCoe_13166

Standard Name

None

Aliases

None

Description

ATP-synt_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

  • hydrogen ion transmembrane transporter activity (IEA) | GO:0015078

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006536208.985825944049381e-37
Oxytricha TrifallaxContig22002.0.g1041.8048513878454153e-35ATP synthase subunit C

WormBaseWBGene000069123.221340285992516e-27
Saccharomyces CerevisiaeYPL234C3.532628572200807e-24Vacuolar ATPase V0 domain subu
nit c'; involved in proton tra
nsport activity; hydrophobic i
ntegral membrane protein (prot
eolipid) containing four trans
membrane segments; N and C ter
mini are in the vacuolar lumen

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13166(Protein)
MATEEVTTQAFFGFMGVTSALVFANLGAAYGTAKSGVGISSMGVIKPELIMKSIIPVVMA
GVLGIYGLIVAVILIQKISDTNYKYYDGYKHLASGLCCGLSSLAAGMAIGIVGDSGVRAN
AQQDKIFVGMILILIFAEALGLYGLIIALILSQ


>SteCoe_13166(CDS)
ATGGCTACCGAAGAAGTAACAACTCAAGCCTTTTTTGGATTCATGGGAGTGACAAGCGCA
TTAGTTTTTGCAAATCTAGGCGCAGCATACGGGACAGCAAAGAGTGGTGTCGGAATTTCA
TCAATGGGTGTAATCAAGCCTGAGCTTATTATGAAATCAATTATCCCAGTTGTCATGGCT
GGTGTTCTTGGTATCTATGGGCTTATTGTCGCAGTCATTCTTATACAAAAAATCAGCGAT
ACAAACTATAAGTACTATGATGGGTATAAGCATTTAGCTTCAGGGCTTTGTTGTGGCTTA
AGCTCTCTAGCTGCTGGGATGGCCATCGGAATTGTTGGGGACTCGGGTGTTCGTGCGAAT
GCCCAGCAAGATAAGATCTTTGTCGGCATGATTCTTATTCTTATCTTTGCTGAAGCTCTA
GGACTTTACGGACTCATTATAGCACTAATATTGTCCCAGTAA