Identifiers and Description

Gene Model Identifier

SteCoe_13355

Standard Name

None

Aliases

None

Description

HAP2-GCS1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010756401.0377033238158346e-53homolog of gamete fusion prote
in (HAP2/GCS1)
Oxytricha TrifallaxContig20776.0.g627.781132241133797e-20Male gamete fusion factor

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13355(Protein)
MFFILIFQRVFASIISSSSLQSCLDQGNSTLTCSQKLFISLSIENGQLSGAENFEATLTS
ISSDSNNITLIYPIKITVAKSQVKARYRLRYIQDFNNKAQELIIAKSIFDCEDGAYSNNP
TCGWKYDSEHKRIWDSQGYCCKCTFEDFLGMNNDQYQRGYACKAFNLGTESATAFCLVWD
DLWYSSYEIFQYDIYYTITVTITKADEFGNYTATSYTISPSTPIINTSDSIIKLIGDFHP
ASPPPSLESFVLFTPSKPLSHYRVLVGSPFWMLLSRDIISFDGSQCNKVGTSYTGFRGQS
NKCSEPINSCFSNQLDNLHIEDIMRISNNQSPLYFASRFGNLTIVRNNDERYLEMQLSGS
FATLLTFELSADSLKFFTSVSKGVIDLAEITSFESLTLDGTLFTQVSNIGSIVASFTLSI
LCSEGVSPISAIPLSLDSMQSKQIISKVAVINESAKNYSCDIQLLDSIGQITDSFRLYFN
TSDRHTDQGTQGGEGKNPDGANSIDKKSTNLGCSDYCPDWYDLACFVSKGCWESFFTFFG
IIIGIIIALIAIKIVIKRYGLCCQKCFPDKNP


>SteCoe_13355(CDS)
ATGTTTTTTATACTGATTTTTCAGCGTGTCTTTGCATCAATCATCTCTTCAAGCTCATTA
CAATCTTGCTTAGATCAAGGGAATAGCACTTTAACTTGCTCTCAGAAGCTCTTTATATCC
TTATCAATAGAAAATGGTCAACTTTCAGGGGCTGAAAATTTTGAGGCTACACTTACTTCA
ATATCTTCAGATTCTAACAATATCACTTTGATATATCCAATAAAAATCACTGTGGCTAAA
TCTCAAGTCAAAGCTCGATATAGATTAAGATACATTCAAGATTTCAATAATAAAGCTCAG
GAACTTATTATCGCAAAATCTATTTTTGATTGCGAAGATGGAGCCTATTCCAATAATCCA
ACGTGCGGATGGAAATATGATTCTGAGCATAAAAGAATTTGGGACTCCCAAGGTTATTGC
TGCAAATGTACCTTTGAAGATTTTCTTGGAATGAATAATGATCAATATCAAAGAGGATAT
GCATGTAAAGCTTTTAATCTAGGAACTGAGTCTGCTACTGCATTTTGCTTAGTATGGGAT
GATTTGTGGTATTCAAGCTATGAAATATTTCAATATGATATTTATTACACCATTACTGTA
ACAATAACTAAAGCAGATGAATTCGGCAACTATACGGCTACAAGCTATACTATTTCTCCA
TCTACACCTATTATCAATACTTCAGATTCTATAATAAAACTAATTGGTGATTTTCATCCT
GCATCTCCCCCACCATCTCTTGAGTCTTTTGTTCTTTTTACTCCTTCTAAGCCATTATCT
CATTATAGAGTCTTAGTAGGATCTCCTTTTTGGATGCTTTTAAGCAGAGATATAATATCC
TTTGATGGTTCTCAATGTAATAAAGTAGGGACCAGTTATACAGGATTTAGAGGACAATCT
AACAAATGCTCAGAGCCAATTAACTCTTGCTTCAGTAATCAGCTAGACAATTTACATATT
GAAGATATTATGAGAATTAGTAATAATCAAAGTCCTTTATATTTTGCAAGCAGGTTTGGA
AATTTAACTATTGTTAGAAATAATGACGAAAGATATTTAGAAATGCAACTTAGCGGAAGT
TTTGCAACTTTACTTACTTTTGAATTAAGTGCAGATTCTCTTAAATTTTTTACCTCAGTA
AGCAAGGGTGTGATTGATCTTGCTGAGATAACATCATTTGAATCTCTGACATTAGATGGG
ACACTTTTTACTCAAGTTAGTAATATTGGATCAATAGTAGCATCTTTTACTTTATCAATA
CTTTGCTCTGAAGGTGTTTCACCTATCTCAGCGATTCCTTTATCATTGGATTCAATGCAA
AGCAAACAAATCATTTCCAAAGTTGCAGTGATTAATGAAAGTGCTAAAAATTATTCATGT
GACATTCAACTATTAGATTCAATTGGTCAAATAACAGATAGTTTCAGATTGTATTTTAAC
ACCTCAGATAGACATACAGATCAAGGAACCCAAGGTGGAGAAGGTAAAAATCCTGATGGA
GCTAATAGCATTGATAAAAAATCCACTAATTTAGGATGCTCAGATTATTGTCCAGATTGG
TATGATCTTGCTTGCTTTGTGTCTAAAGGCTGTTGGGAAAGCTTTTTCACCTTTTTTGGA
ATAATTATTGGTATTATTATAGCATTAATTGCAATTAAAATTGTAATCAAAAGGTATGGT
CTCTGCTGCCAAAAATGCTTTCCAGATAAAAATCCGTAA