Identifiers and Description

Gene Model Identifier

SteCoe_13450

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000105562.2856936767186716e-49
Oxytricha TrifallaxContig1225.1.g1075.0345753587649823e-45WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_011131008.194012623990515e-40Homolog of yeast ASC1
Saccharomyces CerevisiaeYMR116C2.2273635617957438e-39G-protein beta subunit and gua
nine dissociation inhibitor fo
r Gpa2p; ortholog of RACK1 tha
t inhibits translation; core c
omponent of the small (40S) ri
bosomal subunit; regulates P-b
ody formation induced by repli
cation stress; represses Gcn4p
in the absence of amino acid
starvation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13450(Protein)
MNQGESLQHVGDLKGHGGWVTALVTGNSDHSDLLVSVSRDRSLLIWKTFTTSDQGQISSV
KGTTYRRLTGHSHFISDVVLSSDNNFALTSSWDNTMRLWDLRAGRTTYRFVGHTKDVLSV
TMSPDNRQIISGSRDKTIKLWNTLAECKYDFEPQNSHSDWVTCVRFTPTTKDPMIITAGW
DNLVKLWDQQTFKHKADLKGHTGCVNSINVSPDGNFCASGGKDCMAMIWQIKDNSLLYQL
DTQSSINSLAFSPTRYWLAAATDDGIKVWDLDSKSLINEFTPEVFGKDGQTKIKSPSALS
VAWSSNGDILYGGFTDGVIRAYSVTQN


>SteCoe_13450(CDS)
ATGAATCAAGGCGAAAGCTTACAACACGTAGGAGATCTTAAAGGTCATGGAGGCTGGGTT
ACAGCATTAGTCACTGGTAATTCCGATCACTCTGATCTTTTAGTTTCAGTATCACGTGAT
CGTTCCCTTCTAATATGGAAAACCTTTACAACTTCCGATCAAGGTCAAATCTCTAGTGTA
AAAGGTACAACATACAGAAGACTCACTGGTCATTCTCATTTTATTTCTGATGTAGTCTTA
TCATCTGATAATAACTTCGCCTTAACAAGTTCATGGGACAATACAATGAGACTTTGGGAT
TTAAGAGCTGGTAGAACTACCTATAGGTTTGTAGGTCATACCAAAGATGTATTAAGTGTG
ACAATGTCCCCTGATAATAGACAAATTATAAGTGGTTCAAGAGATAAGACTATTAAGTTA
TGGAACACTTTAGCAGAATGCAAATATGATTTTGAACCACAGAATTCACATTCAGATTGG
GTCACTTGTGTACGTTTTACTCCAACAACTAAAGATCCAATGATTATTACTGCAGGATGG
GATAATTTAGTTAAACTTTGGGATCAACAAACATTTAAACATAAGGCAGACTTGAAAGGA
CATACAGGATGCGTCAATTCGATTAATGTATCTCCAGATGGAAACTTTTGTGCTTCAGGT
GGTAAAGATTGTATGGCTATGATCTGGCAAATAAAAGATAATTCACTACTTTATCAACTT
GATACTCAAAGCTCAATCAATAGTTTAGCATTTTCTCCTACTAGGTATTGGTTAGCTGCA
GCAACTGATGATGGTATCAAAGTATGGGATCTTGACTCTAAATCTTTGATTAATGAATTC
ACCCCTGAAGTATTTGGTAAAGATGGGCAGACTAAGATTAAATCTCCTTCAGCATTATCT
GTAGCTTGGAGCAGTAATGGAGATATTTTGTATGGAGGATTTACTGATGGGGTTATTAGA
GCTTATTCAGTAACTCAAAACTAA