Identifiers and Description

Gene Model Identifier

SteCoe_13519

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6655.0.g845.5210822770285325e-42Utp21 specific WD40 associated
putative domain

Tetrahymena ThermophilaTTHERM_006470709.854154686111257e-34Subunit of U3-containing 90S p
reribosome and Small Subunit (
SSU) processome complexes invo
lved in production of 18S rRNA
and assembly of small ribosom
al subunit
WormBaseWBGene000128871.603810890548638e-28
Saccharomyces CerevisiaeYLR409C1.185064864233981e-27Subunit of U3-containing 90S p
reribosome and SSU processome
complexes; involved in product
ion of 18S rRNA and assembly o
f small ribosomal subunit; syn
thetic defect with STI1 Hsp90
cochaperone; human homolog lin
ked to glaucoma; Small Subunit
processome is also known as S
SU processome

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13519(Protein)
MDCGVLESYRTLGLVCDDKAFKWHREGESSYLSLPLGRGFLTYKLENLKIRYIGCQLDHT
VNAVESYKDLILVAAGKTVSAFHKVRLVKVYLGSEASINEILVFGQYLVALNFAGEVKVW
DCESAELLMTIPLPGKGIHLLHPPTYLNKVLVSMKKGRLVLLNVKTGVKIYDFPAICKNL
TGEISALENAVALDIVAIGLDTGKIVFGNILQDEVLFTFDQTEPVTSLSVCSMPNFEILA
SVGTSGYMNIWDLKNKKIQARIRAHNTFPITKVMFVPNEPLILTSSSSDNSIKQWIFDFE
NPEPRIHKKREGFNTPPNSLRFYNTDHILSISENSLRDISLLNEHQSCFFSSKNIKKSIK
SSSSHIKLPPFSSFASSSAREKDWCNIITCNSQYGILWNYDNKAVGEKPIEKKSKSSVLC
SAVSECGNFGILALEDGSLEKFNMQSGFHQLSFSGKHNGKIVGVDIDSTNSLAVSASDEG
EVYIWDFVIGKLIKVLKGKKIRKIRLHKASNLLAVAVDDGVDVLDVRNGKLARSYDGDRV
GDLAFTADSRWLAFCDETGVRIWDLPSDKLIEWVSFPSKVIALDFSPDGRYLATAHSQSL
GVFLWLNKSYYTQVIVNRSPKQPRQIVGFDVTKGKNFYSKKVVKIKDLQTTPIENPLENV
AALKMPKTITHSTFKTSEMPINRIHALFHLDEIKERNAPIEPPKKPEKVPFFLPDTLGII
TYNEENKDKKEEKTEKPHEKDLSNVLSSPHDVVLEFLKSLAPGKIELNLFGLVNDEEVQK
FIEFLYVAIESQSNYDFLQSVLGCFLRIHSDKLSKEQAKSLADLQQKVWKKIEEIFLFDI
SGLERLID


>SteCoe_13519(CDS)
ATGGATTGTGGAGTACTTGAAAGCTATAGGACATTAGGTCTTGTCTGTGATGATAAAGCT
TTTAAATGGCATCGAGAAGGCGAAAGCAGTTACTTGTCGCTACCTCTTGGTAGAGGATTT
TTGACATACAAACTCGAGAATCTTAAGATAAGGTATATTGGTTGCCAACTTGACCATACA
GTAAATGCTGTGGAGTCGTATAAGGATCTTATCCTTGTTGCAGCTGGGAAAACTGTATCA
GCTTTTCATAAAGTCAGACTGGTTAAAGTGTACTTAGGCTCTGAAGCTTCCATTAATGAA
ATTTTAGTCTTTGGACAGTATTTGGTGGCCTTGAATTTCGCTGGAGAGGTCAAAGTGTGG
GATTGTGAGAGCGCTGAATTGCTGATGACTATTCCACTACCAGGAAAAGGCATTCATTTA
TTACACCCTCCTACTTATCTAAACAAAGTACTAGTGTCAATGAAAAAAGGGAGACTAGTG
CTACTGAATGTGAAAACTGGGGTTAAGATTTACGACTTTCCAGCCATATGCAAAAACTTG
ACTGGAGAGATAAGTGCTTTAGAAAATGCAGTTGCACTTGATATTGTTGCTATAGGCTTA
GACACAGGTAAGATTGTATTTGGAAACATATTGCAAGATGAAGTTCTTTTCACATTTGAC
CAAACTGAGCCTGTAACTTCATTATCAGTATGTTCAATGCCTAATTTTGAAATCTTAGCA
TCAGTAGGAACATCAGGATACATGAACATATGGGACTTAAAAAACAAAAAAATCCAAGCA
CGAATTCGAGCACACAATACTTTTCCAATAACAAAAGTTATGTTTGTGCCTAATGAGCCA
CTTATCCTAACAAGTTCCTCATCTGACAATTCAATAAAACAATGGATATTTGACTTTGAA
AACCCTGAACCACGTATCCACAAAAAAAGAGAAGGTTTCAATACTCCTCCAAATTCGCTT
CGTTTTTATAACACCGACCATATATTATCCATATCCGAAAACTCTCTTCGTGATATATCC
TTACTAAACGAGCACCAAAGCTGTTTTTTCTCAAGTAAAAACATCAAAAAGTCTATAAAA
TCTTCAAGTTCACATATAAAACTTCCTCCATTTTCTTCATTCGCATCTTCTTCAGCAAGA
GAAAAAGATTGGTGTAATATCATAACCTGTAATAGCCAATATGGGATTTTATGGAATTAT
GATAATAAAGCTGTTGGAGAAAAACCTATTGAAAAAAAAAGTAAATCATCAGTTTTATGC
TCAGCTGTAAGTGAATGTGGTAATTTCGGGATTTTAGCTTTAGAAGATGGATCTTTAGAA
AAATTCAATATGCAATCTGGCTTTCATCAATTATCTTTTTCAGGAAAACATAATGGAAAA
ATTGTTGGAGTTGATATTGATTCAACAAACTCATTAGCTGTATCAGCAAGTGATGAAGGG
GAAGTTTATATATGGGATTTTGTTATAGGGAAATTGATAAAAGTACTTAAAGGGAAAAAA
ATAAGAAAAATTAGACTTCATAAAGCTAGTAATTTACTTGCTGTAGCTGTTGATGATGGG
GTTGATGTTTTAGATGTTAGAAATGGGAAATTAGCAAGGAGTTATGATGGAGATAGGGTT
GGAGATTTAGCTTTTACTGCTGATTCAAGATGGCTAGCTTTTTGTGATGAGACAGGTGTG
AGGATTTGGGATTTACCTAGTGATAAACTTATTGAATGGGTGTCATTTCCTAGCAAAGTT
ATTGCTTTAGACTTTAGTCCTGATGGAAGATATTTAGCTACGGCTCATAGTCAGAGTCTT
GGGGTGTTTTTATGGCTTAATAAAAGCTATTATACACAGGTTATTGTCAATAGGTCACCA
AAACAACCTAGACAGATTGTAGGTTTTGACGTGACTAAAGGAAAAAATTTCTATTCGAAA
AAAGTTGTGAAAATCAAAGACCTGCAAACAACACCTATAGAAAACCCTCTTGAAAATGTT
GCAGCTTTAAAAATGCCTAAAACTATAACCCATAGTACATTTAAAACTAGTGAAATGCCT
ATTAATCGTATTCATGCATTATTTCATTTAGATGAGATTAAAGAGAGAAATGCACCTATT
GAACCCCCAAAGAAACCAGAAAAAGTCCCATTTTTTTTACCTGATACATTAGGTATTATT
ACATATAATGAAGAGAATAAAGATAAGAAAGAAGAAAAAACTGAAAAACCTCATGAAAAA
GATCTTTCGAATGTGCTTAGTAGCCCTCATGATGTTGTTTTAGAGTTTTTAAAGTCTCTT
GCTCCTGGGAAAATTGAATTGAATCTTTTTGGACTAGTAAATGATGAGGAAGTACAAAAA
TTTATTGAGTTTCTTTATGTGGCGATTGAGTCTCAGAGTAATTATGATTTTCTTCAAAGC
GTTTTAGGATGTTTTTTGAGAATTCATTCAGATAAACTGAGTAAAGAGCAAGCCAAGTCA
CTAGCAGATTTGCAACAAAAGGTATGGAAAAAGATTGAAGAAATATTTCTTTTTGATATA
AGTGGACTTGAAAGACTAATAGATTAA