Identifiers and Description

Gene Model Identifier

SteCoe_13531

Standard Name

None

Aliases

None

Description

Endonuclease_5 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig36.1.g1249.854154686111257e-34Endonuclease V

Tetrahymena ThermophilaTTHERM_002838402.1705220113036395e-29homolog to human protein ENDOV

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13531(Protein)
MKKKSKFDRAIEAMDPALLKKWADEQLFLKSQLIETDDLSFNFTDQPLKCIGGVDISADK
HNPNRAFASLVIQSFPDFENLHVDVEEVTLDYPYVPGFLAFREVPHLKRLIDKSPIKPQV
VLVDGNGIFHNRGFGLASHLGVITGIPTIGCGKTVFAVDGITVNSVKGLSSMLHHAGDKI
LLTGNSGKVWGCALRATDDSINPIIISVGHKISLDSAVKIVTESCIYRVPEPIRQADKLS
RKPLGS


>SteCoe_13531(CDS)
ATGAAGAAGAAAAGTAAGTTTGACCGAGCTATAGAAGCTATGGACCCAGCTCTTCTAAAG
AAATGGGCTGACGAGCAGCTATTCCTCAAATCCCAACTAATCGAAACTGATGACTTAAGT
TTCAACTTTACCGACCAGCCTTTAAAGTGTATAGGTGGTGTAGATATATCAGCAGATAAG
CACAATCCAAACCGAGCATTTGCCAGTTTAGTCATCCAAAGTTTCCCAGATTTTGAAAAT
CTTCATGTTGATGTTGAAGAAGTCACTTTAGATTATCCTTATGTCCCAGGTTTTCTAGCT
TTTCGTGAAGTACCTCATCTAAAAAGACTTATAGATAAAAGTCCTATAAAGCCACAAGTT
GTATTAGTTGATGGTAATGGTATATTCCATAACCGAGGTTTTGGATTAGCTAGTCATTTA
GGTGTTATAACAGGTATTCCAACAATTGGCTGTGGTAAAACCGTTTTTGCAGTTGATGGA
ATCACAGTAAATAGTGTTAAAGGTCTTTCATCTATGCTTCATCATGCTGGTGATAAAATC
CTCCTTACAGGTAACTCAGGTAAAGTTTGGGGTTGTGCACTTAGAGCTACTGATGATTCG
ATTAACCCAATAATCATATCGGTCGGTCATAAAATTTCTTTAGACAGTGCTGTTAAAATT
GTCACTGAATCTTGCATATATAGAGTACCAGAACCAATAAGACAAGCTGATAAATTGTCT
AGAAAACCTTTAGGATCGTAG