Identifiers and Description

Gene Model Identifier

SteCoe_13537

Standard Name

None

Aliases

None

Description

Ribosomal_L11_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000044243.975449735908647e-31
Saccharomyces CerevisiaeYEL054C3.221340285992516e-27Ribosomal 60S subunit protein
L12A; rpl12a rpl12b double mut
ant exhibits slow growth and s
low translation; homologous to
mammalian ribosomal protein L
12 and bacterial L11; RPL12A h
as a paralog, RPL12B, that aro
se from the whole genome dupli
cation
Oxytricha TrifallaxContig10133.0.0.g1018.75651076269652e-27hypothetical protein

Tetrahymena ThermophilaTTHERM_000287401.9287498479639178e-22Homolog of Yeast RPL12, Human
RPL12, Bacterial RPL11; Riboso
mal protein L11; RNA binding d
omain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13537(Protein)
MPPKVETGEARVVILKTVGGEIGAAASLAPKVGPLGLSPKKVGEDIKAATEKWKGIKVMV
KLTIINRVATVEVIPSASALLVRELAEPPRDRKKVKNIKHNGNLTWDQIRKCAKEMRPRS
GAVTFEGTIKEIVGTAVSVGCQIEKKTPKEIYEMIKNGELDTTEP


>SteCoe_13537(CDS)
ATGCCACCTAAGGTAGAGACAGGCGAAGCCAGAGTTGTGATTCTTAAGACAGTTGGAGGC
GAAATTGGTGCTGCTGCTAGTTTAGCTCCCAAAGTCGGTCCATTAGGTTTATCGCCTAAA
AAAGTTGGTGAAGACATCAAGGCAGCGACTGAGAAATGGAAAGGTATCAAAGTTATGGTA
AAACTAACAATTATCAATAGAGTAGCTACAGTCGAAGTTATTCCTTCTGCATCTGCTCTT
TTGGTTAGAGAGTTAGCTGAACCACCAAGAGATAGGAAAAAGGTTAAGAATATCAAACAT
AATGGGAACTTGACTTGGGATCAGATTAGAAAATGTGCTAAGGAAATGAGACCTAGAAGT
GGTGCTGTTACTTTTGAAGGGACAATTAAGGAAATTGTTGGTACTGCAGTATCGGTTGGG
TGTCAAATTGAAAAGAAAACCCCTAAGGAAATTTATGAGATGATTAAGAATGGGGAATTA
GACACCACAGAACCTTAA