Identifiers and Description

Gene Model Identifier

SteCoe_13552

Standard Name

None

Aliases

None

Description

IBN_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10697.0.g510CRM1 C terminal

WormBaseWBGene000020780

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13552(Protein)
MASLPYLDPNAAFTKDSVLVLDTLVSAMNSSNPSERNYSVQALKDIKEHHNLWIHVDTII
ENAKNPDTKFFALSILEHVISTAWNAVPVDQKTGIKNYIVRLVIDNTSTQASSHFLNKLN
MVLVQIVKREWTTTWRTFIPEICSASKSSQPLCENTMNLLKLLSEEIFSESNNMNSNQKK
QLKTTMNEEFSNIYELCDWVLKTAIKHPGAVQISLIKACLSTLAAFLEWVPPVHIYSGDF
LKFMMDNYLDNMQFRTLTLECLTEVAGITMDVLPTDQHFGMYSTAVLSLIVSSVSKLSMH
YPPKNTDFAQLHASYDSTSQHVLKNFSQHLALFFLAYTQNHLSLIEKVIQSNSLSDTEQQ
IIIQALAGLFSYMISLTSYPEDEIFKICCDFWHNLAKHLYEQKGLDWLGNKLWNAIYREA
INEAKDLLIPKMAKPTEVLVSVDEYGNTIRETVQDTETVALYELMRETLIYLTNIDPEET
ELIIMKKMAKQMDGSEWSWTKVSSLAYAIGSIAGAMNENHEKRFLIHVIKDLLTLCEGKR
GKENKAVVATNIMYVVMQYPRFLLNHWNFLKTVVKKLFEFMHEGHPGIKDMSVDTFLRIA
QNCGAEFIRIHESEDQREPFIFEIIRNLSSTISDLENHQKLVFYQCLGQILSNLCSEQEL
NYHITGALKLVQDQWEKTLAHISTNLQAMQDLEVSRSLAFCIKANESFCQTLGHFYYIQL
NRIFNSLMQVYTTYSQYITTQIATNGPVILNHAYIVNARAVKKRILNLLCCYTKACKMGQ
IIIENYLQVILNVVLGDFVSNSIELREAEVITLTADLTNQLEKGILPYMEIILGLFLDSV
LNMLVQDFTTFPEHRHSFFEMLKAVTAHCFQALLQMPLERFKIAIDTVLWASKHNSTSHA
ELGLLTLKQILDNLLAVETAGYFYQHFYMYILTEILAISTDSSHLPNFKHHTFILGHLFC
LVETGLIQVPLADGISNPEGNKAFVISQLTGILTTNFTNMNAVQIEAFVLALFNRCQDHG
EFKSTLRDFLVTSKEIAVDNPAFYADDRDKELAEATRKKSLVPGLLPGSHY


>SteCoe_13552(CDS)
ATGGCAAGCTTACCATATCTTGATCCAAACGCGGCGTTCACCAAAGATTCAGTTCTAGTC
CTTGACACATTAGTTTCTGCAATGAACAGTTCTAATCCTAGCGAAAGGAACTACTCAGTC
CAAGCACTAAAAGATATCAAAGAGCATCACAATCTGTGGATCCATGTTGACACCATTATA
GAAAACGCGAAAAACCCAGACACTAAGTTTTTTGCCCTTTCTATACTAGAACACGTGATT
TCCACTGCTTGGAATGCAGTGCCTGTGGACCAGAAAACAGGGATCAAAAATTATATAGTA
AGACTAGTAATTGACAACACTTCCACCCAAGCTTCCTCCCATTTCCTAAACAAACTAAAC
ATGGTTCTTGTCCAAATCGTAAAGCGCGAGTGGACAACAACCTGGAGAACCTTCATCCCA
GAAATCTGTAGCGCGTCCAAAAGCAGCCAGCCCTTATGCGAAAACACAATGAACCTTCTC
AAACTCCTAAGCGAGGAAATCTTTTCAGAATCCAACAACATGAACTCTAACCAAAAAAAG
CAACTAAAAACCACAATGAACGAAGAATTCAGTAATATCTACGAACTCTGTGACTGGGTA
TTAAAAACCGCAATCAAGCATCCTGGCGCAGTACAAATTTCTTTAATAAAAGCATGCTTA
TCAACATTAGCCGCATTTCTTGAATGGGTTCCTCCAGTTCATATTTACTCAGGAGATTTT
TTAAAATTCATGATGGACAATTATCTTGATAACATGCAATTCCGAACCTTAACTTTAGAA
TGTTTAACTGAAGTTGCAGGTATAACAATGGATGTTTTACCAACTGACCAACATTTTGGC
ATGTATAGCACAGCAGTTTTAAGCCTTATAGTCAGTTCAGTAAGTAAACTTTCAATGCAT
TATCCTCCAAAAAATACAGATTTCGCTCAACTTCATGCTTCATATGATTCAACCAGTCAA
CATGTACTTAAAAATTTCTCTCAACATTTAGCTTTGTTTTTTTTAGCATATACACAAAAC
CACTTGTCGCTTATAGAAAAAGTTATCCAATCAAACTCACTTTCTGATACTGAGCAGCAG
ATAATAATTCAAGCTTTGGCTGGTTTGTTTTCTTATATGATATCTTTGACGAGTTATCCA
GAAGATGAGATTTTCAAAATTTGTTGCGACTTTTGGCATAATTTGGCTAAACATTTATAT
GAGCAGAAAGGCTTGGATTGGCTTGGGAATAAACTTTGGAACGCGATTTATAGAGAAGCG
ATTAATGAGGCTAAGGATTTGCTTATACCAAAAATGGCTAAGCCTACAGAAGTTTTAGTT
TCAGTAGATGAGTATGGAAATACAATTAGAGAAACTGTTCAAGATACTGAGACTGTAGCT
TTATATGAGCTTATGAGAGAAACACTTATTTACTTAACAAATATTGATCCTGAAGAAACT
GAACTTATTATTATGAAGAAAATGGCTAAACAGATGGATGGAAGCGAATGGTCGTGGACT
AAAGTTTCTAGTCTAGCTTATGCTATTGGGTCTATAGCTGGAGCTATGAATGAAAATCAT
GAGAAACGCTTCTTGATACATGTTATAAAAGACCTTCTGACCTTATGTGAAGGTAAAAGA
GGAAAGGAAAACAAAGCAGTTGTGGCTACGAATATTATGTATGTAGTCATGCAATACCCT
AGGTTTTTGCTTAACCATTGGAATTTTTTGAAAACTGTAGTCAAAAAGCTTTTTGAATTC
ATGCATGAAGGGCATCCTGGGATCAAAGATATGAGCGTTGATACTTTTTTACGTATTGCT
CAGAACTGTGGGGCTGAGTTTATTCGTATACATGAGAGTGAGGACCAGCGTGAGCCGTTT
ATTTTTGAAATAATCCGAAACTTGTCATCAACAATATCTGATCTAGAAAACCATCAAAAA
CTAGTCTTCTACCAATGTTTAGGGCAGATATTAAGTAATCTATGCTCAGAACAAGAGCTT
AATTATCATATAACTGGAGCATTAAAGCTTGTTCAAGACCAATGGGAAAAAACTTTAGCT
CATATAAGTACTAATCTCCAAGCAATGCAAGACTTGGAAGTTTCACGTTCACTTGCCTTT
TGTATAAAAGCTAATGAAAGCTTTTGTCAGACCCTAGGGCATTTTTACTATATACAACTA
AACCGCATTTTCAATAGTTTGATGCAGGTCTACACAACTTATAGCCAATATATAACGACT
CAAATAGCAACAAATGGGCCTGTAATATTAAATCATGCATATATAGTAAATGCTCGAGCA
GTCAAAAAACGCATATTAAATCTCTTATGTTGTTATACAAAAGCATGTAAAATGGGTCAG
ATTATTATAGAAAACTATCTACAAGTTATATTAAATGTCGTCCTTGGGGATTTTGTCAGT
AACTCAATTGAGCTAAGGGAAGCTGAAGTTATAACACTAACTGCAGATCTCACAAACCAG
CTAGAAAAAGGAATTTTGCCTTATATGGAAATAATCCTTGGCTTATTTTTAGACAGTGTC
CTTAACATGCTCGTTCAAGACTTTACAACTTTCCCTGAACACCGACACAGTTTCTTTGAA
ATGCTCAAAGCTGTAACTGCCCATTGCTTCCAAGCCCTTCTACAAATGCCTTTAGAAAGG
TTCAAAATTGCTATAGACACTGTGCTTTGGGCAAGTAAACATAATAGCACTTCACATGCT
GAGCTTGGTTTATTAACTTTAAAGCAAATTCTCGACAATTTATTAGCAGTTGAGACTGCA
GGGTACTTTTATCAGCATTTTTATATGTATATCCTTACAGAAATCTTAGCAATATCAACA
GATAGTTCACATTTACCTAATTTTAAACATCATACTTTCATTCTTGGGCATTTGTTTTGC
CTTGTTGAAACTGGGCTTATACAAGTTCCTTTAGCTGATGGGATTAGTAACCCTGAAGGG
AATAAAGCATTTGTTATAAGCCAGTTGACTGGGATTTTGACTACAAATTTTACTAATATG
AATGCTGTGCAAATTGAAGCTTTTGTCTTGGCGCTATTTAATAGGTGTCAGGATCATGGG
GAATTTAAGAGCACACTTAGAGACTTTTTGGTGACAAGTAAGGAGATTGCGGTTGACAAC
CCTGCGTTTTATGCTGATGATAGAGATAAGGAACTTGCTGAAGCGACAAGGAAGAAGAGT
TTAGTCCCTGGGTTATTACCTGGTAGTCATTATTAA