Identifiers and Description

Gene Model Identifier

SteCoe_13681

Standard Name

None

Aliases

None

Description

EF1_GNE domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYAL003W0.006737946999085467Translation elongation factor
1 beta; stimulates nucleotide
exchange to regenerate EF-1 al
pha-GTP for the next elongatio
n cycle; part of the EF-1 comp
lex, which facilitates binding
of aminoacyl-tRNA to the ribo
somal A site

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13681(Protein)
MAAPNPKELETILSTSAFLCGDRPSAEDNKVFKLFASAPDHTTYPNLWGWYTFVLQFTDA
VKAHWPDLTPKPVEKKPAEEEFEDDLFADDPEAEEEAKKIADAKAADKKQAPVGKSNVVF
DVKPVSSSVDLDVLAKRIFEEVALDGLIWGEQYKKAPVAFGIFKLVIGCTILDTVETEVI
IEKITELSGELKVEDEDEDGEGLGTFATVEDAWVQSVDIANFQKI


>SteCoe_13681(CDS)
ATGGCAGCTCCCAATCCCAAAGAATTGGAAACAATCTTGAGTACTTCAGCTTTCCTCTGT
GGAGATCGTCCAAGTGCTGAAGACAACAAAGTCTTTAAGCTCTTTGCATCAGCTCCAGAT
CACACTACTTATCCAAACCTTTGGGGATGGTATACTTTTGTCTTGCAATTCACTGATGCT
GTAAAAGCTCATTGGCCAGATCTTACACCAAAACCAGTTGAAAAGAAGCCTGCTGAAGAA
GAATTCGAAGATGATCTCTTCGCTGACGACCCAGAAGCTGAAGAAGAAGCGAAGAAAATC
GCTGACGCTAAGGCTGCAGATAAGAAACAAGCTCCAGTTGGTAAAAGTAATGTGGTCTTT
GATGTGAAACCTGTGAGCTCATCTGTTGATCTTGATGTCTTAGCTAAAAGAATTTTTGAA
GAAGTTGCTTTAGATGGATTGATTTGGGGTGAGCAATATAAGAAAGCACCAGTAGCCTTT
GGAATTTTCAAACTCGTCATTGGATGCACAATTCTTGATACTGTAGAAACTGAAGTTATT
ATTGAAAAAATCACAGAGCTTTCTGGTGAACTTAAGGTTGAAGATGAGGATGAAGATGGG
GAAGGCCTTGGCACATTTGCCACTGTTGAAGATGCTTGGGTGCAAAGTGTGGATATCGCC
AACTTCCAAAAGATTTAG