Identifiers and Description

Gene Model Identifier

SteCoe_13738

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010065401.2479464629129513e-47hypothetical protein
Oxytricha TrifallaxContig6988.0.g511.9287498479639178e-22WD domain, G-beta repeat

WormBaseWBGene000064744.248354255291589e-18
Saccharomyces CerevisiaeYCR072C3.1391327920480296e-17WD-repeat protein involved in
ribosome biogenesis; may inter
act with ribosomes; required f
or maturation and efficient in
tra-nuclear transport or pre-6
0S ribosomal subunits, localiz
es to the nucleolus

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13738(Protein)
MDQSFQDPLLIQDPNVETQDISESGHVITEAPESHDEKTQLIKVIEEIQSEKEFTLSGHS
QSVLSISFSPDGKYIASSSADNSVKVWKITTKKLDFSLTGHRGFVNSTSFSPDGKYLATG
SNDKTIKVWNFKDKKEEMSLSGHNSSVLSTSFSQNSMYILSGSDDKSIRLWNVTKKSMEH
KFEGHEAQVRAVLFTPDENFVISGSSDKVIKVWNIQSKDMKYELKGHKREITSLALSFNG
VYLASASADKSVIVWNLTKKSLEFVLNGHTDSVKSVYFSVDAKFIISGSADKSIKTWDFY
SRKEESTRFGHNSEVNSVCYSPDGRYFASGSLDKMVKVWKLHEQKDENTLSGLNGSVTSV
AFSVDKGSLACVTENGDLMIYDILTKKLQFKDEAHNTLANCVQYSKNGKLLATCSDDKTV
QVRAVPGYSIIQVLEGHLDFVNYVCFCPKTDLLASCSADKSIKIWDLSNHSLSHTLLSHT
SSVNQVCFSSDPKYLASASDDESIKIWNLLHNKLEFTLSGHTKPVRTLSFSPNGHKIISG
SADKTLKIWNILDMREEFSLLGHQSPINSVCFTEDGKYIVSGSSDKTIKVWSLHEKIELF
KLTGHSAKINCISFSIDGKTLASASNDESVKLWKLSNQCEDRCFSYKIEVSCLAYSPDGK
LFAIGSFDQSLIVYSLPDYTEFRRFDLESQVRSLAFTTEGGAVACGTYAGTIFYCNFEYI
EEKKIVKGHSDVVSCLCFNRDDMELVSGSLDKSIKVWSYPKFDEKCSLLGHTQAVKCVIY
SFDYKQIISGSEDLTIKFWDTQKKQLDFTFVGHTGAVNTIALSFKGNYLISGSDDCSIKI
WNINHTREEFTFPGQNLRIFSISFSPHGTRIASGLENGFIKVWNIREKREEYTFHAHTKS
IKSIQYSNDGNYLASSSEDGQVKIWDIQDYTEDSSEQIISANSISFSPNGKHLLVGASDN
TLTLWRFHKNIEDNTFSSHNDYIKCVCYSPDGNIFASASADTTIKLWKSENGHEIATLKA
HKQAVNSIGFNSKGTLLVSASDDNSIIVWNVAKKKLVFKLAGHISYVNCVGFSPDDEYIA
SGASDNYVIFWSVSRREKEFIFYEHLDWVRALAFSSDRRLFATGSGDKLVKLWNYREKKK
VHDLIGHFADVYCVAFSPNGKTLASGSADKIIIVWNIQDGNYEFKLDNVNDFVRCLAFST
DNKYLAAGFFNKPVHLWTMSLDREHCELRAHSNIIYSVEYSPNGNVIASAGIDASVIIWS
TKNMAKTHTLSEHKKCVMCLSFSPKGNLLASGSVDKTIIIWETEKFKKIEVLREHKEEVT
CLCFSSDSEYLASGSLDKSIIIRKTSTLKVFQILNIHNSKVSGLVFHPKNIEILSCGYDG
YIKCSNYITLQSIFTIAASKFILRSIDISPDGNFIACGTKDPLVLIYEYSTQNIYFTGKR
HKDQVNTVKFSGDGKLLASGCSGSLAQVGLCYKAITIWSVYDKMELFTLTGHNSNVNSVS
FSQDSKFLASASADKTIKIWNLAAERETFCLSKSIEETYASTMTTKNEPVTEKAMRHNEL
YETRLITNSIYSNKFQDPFVHKNLLFCIKSKDYSNLSSKSLDCLVSNLNFSGLHFLVFQN
MSKVLKKHSANSKFSLKADVFGHSPLYYSIKKHNRQCTDILLNYLISLTKKPNSQHFLTS
MYSIRHDFPMIIQNSSTHLNRFLTSIFYLKSKEIQFGIPNMRLPSTKLLHSASPVASDFF
DVVKSSEEQPMLIKSLPFKIEANIGTRASLYLLNSILSCKNEDIYRTEVIQIIIRYHWNI
IRYYIYVYTGILWLNLVMLVLAIRNPESLNFGPFLIINAFLFTWEVLQWANSGIDYFLDI
WNIIDIARILTTLAWIYFSFLNIHNAILTWVAVMLNILRGLTGFRAFGKTRYYVRLIFQC
LNDIKYFLLIFAYTTVGFGLLNITATHDKLIDFSNLWLLPFKLAFGDTDGMSASIFDTQF
ITFTLALMINVVLMLNMIIAILGDSYDEFQLKSQIYDYKEMIEVTLEIEQILSLKNLDAN
YMYLHACVNPFDCEDMWEGKVLDFRSNIKRVSKEIGKGNLAVQTKLDMIEERLSKETKTL
ENSLKSMENKVEYSLNLFRDDFKNVNSRIDLHIINNPSTQVKTQSIHEHFENICKTLETK
LDSQSFAIKSFEKLFENDRKTRETQSSSDKKFIITTLNKDIELYSSNMQALHSSLLDLIT
NSSQSLHTKLNNDYKTLEQSLEKYKELYNDQGEISRKYIDQALELQHKFLALNMESNKKY
IEEMIEKHKKEIEEKIEEYRQTIEKTIEKQDQNKYEIIEKNDKLIEEIVECYKKSAENIG
KNTESFEGLFNENIKKIDEKILDNYKMIEEKMHEYEENIKEMLKEERERIENSLKKDMIN
EITQKVEEVKRQIEDKNTGVVEKIIGYEGKIMMFQEKVQELHGKMCESTVETHKNISQVD
EDIKNLALNIRNLGDDTKTSDLTQRVTTLQGNFDEIHNQISTMDSKMNSFLSNASQYESK
YAEVSDKISSIESHYSSVSHKLENLNDKFEKILGLLTKSQGEN


>SteCoe_13738(CDS)
ATGGATCAATCTTTTCAAGACCCTCTACTCATCCAAGACCCAAATGTGGAAACTCAAGAC
ATTAGTGAATCAGGTCATGTAATTACTGAAGCGCCAGAAAGTCATGATGAGAAAACTCAA
CTAATCAAAGTTATCGAAGAAATTCAAAGCGAAAAAGAATTTACATTATCAGGACATAGC
CAATCTGTCTTAAGCATATCATTTAGCCCAGATGGTAAATATATAGCAAGTAGTTCAGCT
GATAACTCAGTCAAAGTATGGAAAATTACTACAAAAAAACTAGACTTCAGCCTTACTGGG
CACAGAGGATTTGTAAATTCCACATCATTCAGCCCTGATGGGAAGTATTTAGCAACAGGT
TCTAACGATAAAACAATTAAAGTGTGGAATTTCAAAGATAAAAAAGAAGAAATGAGTCTT
TCTGGGCATAATTCCTCAGTCCTCTCCACATCTTTCAGTCAGAATTCAATGTATATTTTA
TCAGGTTCAGATGATAAATCAATAAGACTATGGAATGTGACTAAGAAATCAATGGAACAT
AAATTTGAAGGACATGAAGCTCAGGTAAGGGCTGTGCTTTTTACACCTGATGAGAATTTT
GTCATATCAGGCTCAAGTGATAAAGTTATAAAAGTATGGAATATTCAAAGTAAAGATATG
AAATATGAACTTAAAGGACATAAAAGAGAAATTACATCACTTGCTTTAAGCTTTAATGGT
GTATATCTTGCTAGTGCTTCAGCAGATAAAAGTGTGATTGTATGGAATCTTACTAAAAAA
AGTCTTGAATTTGTATTAAATGGACATACAGACTCAGTAAAAAGTGTTTATTTTAGTGTT
GATGCGAAATTTATTATATCAGGTTCAGCTGATAAGTCTATAAAAACCTGGGATTTTTAT
AGTCGTAAAGAGGAATCTACACGGTTTGGCCACAATTCTGAAGTAAATTCTGTTTGTTAT
AGTCCTGATGGAAGATATTTTGCCAGTGGATCTTTAGATAAAATGGTTAAAGTGTGGAAA
TTGCATGAACAAAAAGATGAAAATACACTTTCTGGATTAAATGGATCTGTTACATCAGTA
GCGTTTAGTGTTGATAAAGGGAGTTTAGCTTGTGTTACAGAGAATGGAGATTTGATGATC
TATGATATTTTGACTAAAAAATTACAATTTAAAGATGAGGCACATAATACTTTGGCTAAT
TGTGTACAGTATAGTAAGAATGGGAAATTGTTGGCAACTTGCTCAGATGATAAAACTGTA
CAGGTTAGAGCTGTTCCTGGGTATTCAATTATCCAAGTACTTGAAGGGCATTTAGATTTT
GTTAACTACGTGTGTTTTTGTCCTAAAACTGATCTTTTAGCTTCTTGTTCTGCTGACAAA
TCTATTAAGATCTGGGACCTTTCAAACCATTCCCTCTCTCATACCTTATTAAGTCACACT
TCCTCCGTAAACCAAGTGTGCTTTAGTTCTGACCCTAAATACCTCGCAAGTGCATCAGAT
GATGAAAGTATTAAAATCTGGAATCTCCTTCACAATAAGCTTGAATTTACTCTTTCAGGA
CACACAAAACCAGTAAGAACCTTATCTTTCAGTCCAAATGGTCATAAAATCATTAGTGGT
TCTGCAGACAAAACCTTAAAAATCTGGAACATCCTAGATATGCGTGAAGAATTCTCCCTT
TTAGGCCATCAATCTCCAATAAACAGTGTATGTTTTACAGAAGATGGGAAATATATAGTC
AGTGGCTCATCAGACAAAACTATAAAAGTTTGGAGTCTACATGAAAAAATCGAACTTTTT
AAACTCACTGGACATTCTGCTAAAATTAATTGCATAAGTTTTAGTATTGATGGGAAAACC
TTAGCAAGTGCTTCTAATGATGAAAGTGTTAAACTTTGGAAACTATCAAATCAATGTGAA
GATAGATGTTTTAGTTATAAAATAGAAGTTAGCTGTTTAGCTTATAGTCCTGATGGAAAA
TTATTTGCTATTGGGTCTTTTGATCAGAGTTTAATTGTTTATAGTTTACCTGATTACACA
GAGTTTAGGAGATTTGATTTAGAATCACAGGTTAGGAGTTTAGCTTTTACAACAGAAGGT
GGGGCGGTAGCTTGTGGAACTTATGCTGGGACTATATTTTATTGTAATTTTGAATATATT
GAAGAGAAAAAAATTGTTAAAGGTCATAGCGATGTTGTTAGTTGTTTGTGCTTTAATAGA
GATGATATGGAATTAGTAAGTGGTTCGTTAGACAAGTCTATTAAAGTGTGGAGTTATCCG
AAATTTGATGAAAAATGCTCACTTTTGGGACATACACAAGCTGTTAAGTGTGTTATTTAT
AGTTTTGATTATAAACAAATTATCAGCGGTTCTGAAGATTTAACTATAAAATTTTGGGAC
ACTCAGAAAAAACAACTCGATTTCACATTTGTCGGCCATACTGGAGCTGTAAACACTATT
GCTCTTAGTTTTAAAGGAAACTATCTAATATCCGGTTCAGATGACTGCTCAATCAAAATA
TGGAATATAAATCATACTCGTGAAGAATTCACATTCCCTGGACAAAACCTAAGAATTTTC
TCTATCTCCTTCAGCCCACACGGGACAAGAATTGCAAGTGGCCTCGAAAATGGTTTCATA
AAAGTCTGGAACATACGCGAAAAGCGTGAAGAATATACTTTCCACGCACATACCAAATCT
ATAAAATCAATTCAATACAGCAACGATGGAAACTACCTAGCCAGTAGTTCAGAAGATGGT
CAAGTAAAAATATGGGACATCCAAGATTACACAGAAGACTCTTCAGAACAAATAATTTCA
GCAAATAGTATATCTTTTAGCCCAAATGGTAAACATCTTCTAGTAGGTGCATCAGATAAT
ACCTTAACCCTTTGGCGTTTTCATAAAAATATCGAAGATAACACTTTTTCTTCACATAAT
GACTATATAAAATGTGTATGCTACAGTCCTGACGGTAATATTTTTGCTAGTGCTTCAGCT
GATACAACAATAAAATTATGGAAATCAGAAAATGGACATGAAATAGCTACATTAAAAGCT
CATAAACAAGCTGTGAATTCAATTGGATTTAACTCAAAAGGCACATTATTAGTAAGTGCA
TCTGATGATAATTCTATTATTGTATGGAATGTTGCTAAGAAAAAACTGGTTTTCAAATTG
GCTGGGCATATTTCTTATGTGAATTGTGTTGGATTTTCACCTGATGATGAATATATTGCT
AGTGGGGCAAGTGATAATTATGTTATATTTTGGAGTGTTAGCAGAAGAGAGAAAGAGTTT
ATATTTTATGAACATTTAGATTGGGTTAGAGCTTTAGCTTTCAGTTCTGATAGAAGACTT
TTCGCTACAGGATCAGGAGATAAATTAGTGAAATTATGGAATTATAGGGAAAAAAAGAAG
GTTCATGATCTGATTGGCCATTTTGCTGATGTGTATTGTGTTGCTTTTAGTCCTAATGGT
AAAACTTTAGCTAGTGGCTCAGCGGATAAAATAATTATTGTATGGAATATTCAAGATGGG
AATTATGAGTTTAAACTAGACAATGTCAATGATTTTGTTAGATGTTTGGCTTTTTCAACT
GATAATAAGTATTTGGCTGCTGGCTTTTTTAATAAACCAGTACATCTTTGGACTATGAGT
TTAGATAGAGAACATTGCGAACTTAGAGCTCATTCTAATATTATATATAGTGTTGAATAT
TCTCCTAATGGGAATGTTATAGCAAGTGCAGGTATTGACGCTTCAGTTATAATCTGGAGT
ACAAAAAACATGGCTAAAACTCATACATTAAGCGAGCATAAAAAGTGTGTCATGTGTTTA
TCCTTCAGCCCTAAAGGAAATTTATTAGCAAGTGGCTCAGTAGATAAAACAATAATTATT
TGGGAGACTGAAAAATTTAAAAAAATCGAAGTTCTCCGTGAGCATAAAGAAGAAGTGACT
TGCTTATGTTTTTCTTCAGATAGCGAATACCTAGCATCTGGGAGTTTAGACAAATCTATA
ATCATAAGAAAAACCTCAACTTTAAAAGTATTTCAAATTTTAAACATCCACAATAGTAAA
GTTAGTGGACTGGTATTTCATCCGAAAAATATAGAAATACTCTCTTGTGGCTATGATGGA
TACATAAAATGTTCAAATTATATAACCCTACAAAGCATTTTTACTATAGCAGCCAGTAAA
TTTATTTTAAGAAGTATCGACATAAGCCCTGATGGAAATTTTATAGCATGTGGAACAAAA
GACCCTCTTGTTCTTATATATGAATACTCAACACAAAACATATACTTTACAGGAAAAAGA
CATAAAGATCAAGTCAATACCGTAAAATTCAGTGGTGATGGGAAACTTTTGGCTAGTGGA
TGTAGTGGGTCTTTAGCTCAAGTTGGTTTATGCTACAAAGCTATAACAATATGGTCTGTT
TATGATAAAATGGAACTTTTTACACTTACTGGGCATAACAGCAATGTTAATTCTGTTAGT
TTTAGTCAAGACTCGAAGTTTTTAGCATCAGCTTCTGCTGACAAAACGATAAAAATTTGG
AATTTAGCTGCAGAAAGGGAAACTTTTTGTCTTAGTAAAAGCATAGAAGAAACATATGCT
TCAACAATGACTACAAAAAATGAACCTGTAACAGAAAAAGCTATGAGACATAATGAACTA
TATGAGACAAGGCTTATCACAAATTCTATATATTCCAACAAATTCCAAGACCCATTTGTG
CATAAAAATCTTCTTTTTTGCATCAAATCAAAAGACTACTCTAATCTTTCAAGTAAATCT
TTAGATTGTCTTGTGTCTAATCTGAACTTCTCAGGACTCCATTTTCTGGTTTTCCAAAAC
ATGTCGAAAGTCTTAAAAAAACACTCAGCCAACAGCAAATTCTCTTTAAAAGCTGATGTT
TTTGGCCACTCACCTTTGTATTATTCTATAAAAAAACATAATAGACAATGTACTGATATA
CTACTAAACTATCTGATTTCGCTTACAAAAAAACCTAATTCCCAACATTTTCTTACAAGT
ATGTATTCAATAAGACATGATTTCCCAATGATAATCCAAAACTCTTCAACGCATTTAAAC
CGTTTTTTAACATCAATTTTTTATTTGAAATCCAAAGAAATCCAGTTCGGAATTCCAAAC
ATGAGGCTCCCAAGCACTAAACTTTTACATTCAGCCAGTCCTGTAGCCAGTGATTTTTTT
GATGTAGTTAAAAGTTCAGAAGAACAGCCAATGCTAATAAAAAGCTTACCATTCAAAATC
GAAGCTAATATTGGGACCAGAGCAAGTCTTTATCTTTTAAACTCAATATTATCATGTAAA
AATGAAGATATTTATCGAACTGAAGTTATACAGATTATTATAAGATATCATTGGAATATT
ATAAGATATTATATATATGTATACACTGGAATATTATGGCTTAACCTTGTAATGCTTGTT
TTGGCTATTCGCAACCCAGAATCTTTAAATTTCGGTCCTTTTCTTATAATCAATGCATTT
TTGTTTACTTGGGAAGTCCTCCAATGGGCTAATTCTGGTATTGATTATTTTTTAGATATA
TGGAATATTATAGATATTGCTAGAATTTTAACCACCCTAGCTTGGATTTATTTCAGTTTT
CTTAATATACATAATGCTATACTAACTTGGGTTGCTGTTATGCTTAATATACTCAGAGGA
CTTACTGGTTTTAGAGCATTTGGTAAAACTAGATACTATGTCCGGCTTATTTTCCAATGT
TTAAACGACATAAAATACTTTTTATTGATTTTTGCTTATACAACTGTTGGATTTGGTCTA
TTAAACATAACCGCTACACATGATAAACTTATTGATTTCAGCAATTTATGGCTTTTACCT
TTTAAACTTGCTTTTGGGGATACAGATGGTATGTCAGCTTCAATATTCGACACTCAGTTT
ATAACTTTTACTTTAGCTTTGATGATAAATGTTGTTTTAATGCTTAATATGATTATTGCT
ATATTAGGGGATTCATATGATGAATTTCAACTTAAATCTCAGATTTATGATTATAAAGAA
ATGATTGAGGTTACTTTAGAGATAGAGCAGATATTGTCTTTGAAAAATTTAGATGCTAAT
TATATGTATTTACATGCTTGTGTTAATCCTTTTGATTGTGAAGATATGTGGGAAGGAAAA
GTATTGGATTTTAGAAGTAATATTAAGCGTGTTAGTAAAGAGATTGGGAAAGGGAATTTG
GCTGTCCAGACAAAGTTGGATATGATAGAAGAGAGGCTTAGTAAAGAAACAAAGACATTG
GAGAATAGTTTGAAAAGTATGGAGAATAAAGTTGAATATTCTTTGAATTTGTTTAGAGAT
GATTTTAAGAATGTGAATTCTAGGATTGACCTTCATATTATAAACAATCCATCAACACAA
GTAAAAACGCAGTCTATTCATGAACATTTCGAGAATATATGCAAAACGTTAGAAACTAAA
TTAGATAGTCAGTCATTTGCAATAAAAAGTTTTGAGAAATTATTTGAAAATGATAGAAAA
ACCAGAGAGACACAATCTTCTTCAGATAAAAAATTTATTATTACCACATTAAATAAAGAT
ATCGAGTTATATTCTTCAAATATGCAAGCATTACACTCATCTTTACTAGATCTTATAACA
AATTCATCACAATCTTTACACACAAAATTAAATAATGATTATAAAACCCTTGAGCAAAGT
TTAGAAAAATATAAAGAATTATATAATGACCAAGGAGAAATATCAAGAAAATACATAGAC
CAAGCATTAGAACTCCAACACAAATTTTTAGCTTTAAATATGGAATCTAATAAAAAATAC
ATTGAAGAAATGATTGAAAAACATAAAAAAGAAATAGAAGAAAAAATAGAAGAATATAGA
CAAACTATAGAAAAAACAATAGAAAAACAAGATCAAAACAAATATGAAATTATTGAAAAA
AATGATAAATTGATAGAAGAAATTGTGGAATGCTATAAAAAAAGTGCTGAAAATATAGGG
AAAAATACTGAATCTTTTGAAGGGTTATTTAATGAGAATATTAAGAAAATCGATGAGAAA
ATATTAGATAATTATAAGATGATAGAAGAGAAAATGCATGAATATGAAGAAAACATAAAG
GAAATGCTTAAAGAAGAAAGAGAAAGAATAGAGAATAGTTTGAAAAAGGATATGATAAAT
GAAATTACTCAGAAAGTAGAAGAGGTTAAAAGGCAGATTGAAGATAAAAACACTGGGGTT
GTGGAGAAAATTATTGGATATGAAGGGAAAATAATGATGTTTCAAGAGAAAGTCCAAGAA
TTGCATGGTAAAATGTGTGAAAGCACAGTGGAAACACATAAAAACATAAGCCAAGTTGAT
GAAGATATAAAAAACCTTGCTTTAAACATTAGAAATCTTGGTGATGATACTAAAACATCA
GATCTTACTCAGCGTGTTACCACTTTGCAAGGTAATTTTGATGAAATACATAATCAAATT
AGCACTATGGACTCAAAAATGAACTCATTTTTATCAAATGCTAGTCAGTACGAATCAAAA
TATGCTGAAGTTTCAGACAAAATTTCAAGCATTGAAAGCCATTACTCTTCAGTTTCTCAT
AAACTTGAGAACTTGAATGATAAATTCGAGAAAATACTCGGGCTGCTTACCAAAAGCCAA
GGTGAAAACTAA