Identifiers and Description

Gene Model Identifier

SteCoe_13752

Standard Name

None

Aliases

None

Description

ERK subfamily kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19712.0.g790Protein kinase domain

WormBaseWBGene000034012.2856936767186716e-49
Saccharomyces CerevisiaeYBL016W3.392270193026015e-47Mitogen-activated serine/threo
nine protein kinase involved i
n mating; phosphoactivated by
Ste7p; substrates include Ste1
2p, Far1p, Bni1p, Sst2p; inhib
its invasive growth during mat
ing by phosphorylating Tec1p,
promoting its; inhibits recrui
tment of Ste5p, Cdc42p-mediate
d asymmetry and mating morphog
enesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13752(Protein)
MRAQSKSGSRSHDANKVKPNTGKVSFEVSGTTFTVDDHYQYIKQIGHGAYGVVVSATDRR
SGNKVAIKKIPKTFEDLIDAKRILREIKLLTFFEHENIISLIDLLRPPARTGFEDIYIIT
DLMETDMHRVIYSRQDLSDEHIQYFMYQLMRGLLFMHSADVIHRDLKPSNLLLNKNCDLK
ICDLGLARGFDNAKDDNLTEYVVTRWYRAPEVILNASHYSKALDIWGTGCVFAELLGRSP
LFPGEDYLDQVQRIIAVLGMPSQEDMSFIGNESAKRYIKSLPKRQRVPWSTLYPKANPIA
LDLLNNMLVFNPDNRFNVEECLAHPYFEGLHNVDEEPVAKKVFDWSFDNFTPTKPILQSM
MYDESLKFHPV


>SteCoe_13752(CDS)
ATGAGAGCTCAGTCAAAGTCTGGATCCAGATCCCACGATGCAAATAAAGTGAAGCCGAAT
ACAGGAAAAGTTTCCTTCGAAGTTTCAGGCACTACCTTCACAGTGGACGATCATTACCAG
TACATTAAGCAGATAGGTCATGGGGCTTATGGCGTGGTGGTTAGTGCAACGGATCGTCGA
TCAGGAAATAAAGTTGCAATAAAAAAAATCCCCAAAACATTTGAAGACCTCATAGACGCG
AAAAGAATTCTCCGTGAAATCAAACTCCTCACTTTCTTCGAGCATGAAAATATAATTTCA
CTAATTGACCTGTTGAGGCCACCAGCACGAACAGGTTTTGAAGACATTTATATCATCACT
GACCTTATGGAAACTGATATGCATCGAGTTATTTATTCAAGACAAGACTTAAGCGATGAA
CATATCCAGTATTTCATGTATCAATTGATGCGGGGTCTTCTTTTCATGCACTCAGCTGAT
GTCATCCATAGAGATCTTAAGCCTAGCAATTTGTTGTTGAACAAAAATTGCGATTTGAAA
ATTTGTGACTTAGGACTTGCCCGAGGTTTCGACAACGCAAAAGATGATAATTTGACTGAG
TATGTAGTAACCAGATGGTACCGCGCACCTGAAGTTATTCTTAATGCTAGCCATTATAGT
AAAGCTCTAGACATATGGGGTACTGGCTGTGTTTTTGCTGAACTTCTTGGTAGATCTCCA
CTTTTCCCGGGTGAAGATTACCTTGATCAGGTGCAAAGAATCATTGCAGTCCTTGGAATG
CCAAGCCAAGAAGATATGAGTTTTATCGGAAATGAATCAGCGAAAAGGTATATTAAAAGC
TTGCCTAAACGTCAGAGAGTTCCCTGGAGCACTTTGTACCCTAAAGCTAATCCTATTGCT
TTGGATCTTTTGAATAATATGCTTGTATTCAACCCTGATAACAGATTTAATGTCGAGGAG
TGCTTGGCTCACCCCTACTTTGAAGGTCTGCACAATGTTGATGAGGAACCTGTAGCTAAA
AAGGTTTTTGACTGGAGTTTTGACAATTTCACCCCAACAAAGCCTATTTTACAGTCAATG
ATGTATGATGAATCTCTCAAATTCCACCCTGTGTAG