Identifiers and Description

Gene Model Identifier

SteCoe_13776

Standard Name

None

Aliases

None

Description

Lactamase_B_6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17827.0.g1080Beta-Casp domain

WormBaseWBGene000086427.362997122252211e-76
Tetrahymena ThermophilaTTHERM_003397902.001470128041443e-75RNA-metabolising metallo-beta-
lactamase family protein
Saccharomyces CerevisiaeYLR277C2.2273635617957438e-39Putative endoribonuclease; sub
unit of the mRNA cleavage and
polyadenylation specificity co
mplex; required for 3' process
ing, splicing, and transcripti
onal termination of mRNAs and
snoRNAs; protein abundance inc
reases in response to DNA repl
ication stress; YSH1 has a par
alog, SYC1, that arose from th
e whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_13776(Protein)
MSIEIIPLGAGKEVGRSCILVKMAGRTVMFDCGVHMGYDDERRYPYFSYLGNTTDYTPLI
DVVLITHFHLDHCGALPYFTEMKGYNGPVIMSAPTRAIIPLMLDDFRKVCVEHKGETNFY
TQEQIKECISKVRTIELHQTLTIGDINIRAYYAGHVLGAVMYYVECRGHSVVYTGDYNVV
GDRHLRSAWIERLDPHVVISESTYATKFRELKMRREKVFLKKVMQTIDRGGKVLIPVFAL
GRAQELCILLDTYWQRAQLECAVHFAGTLTEKANQLYKTFINWCNENVQRVFLSRNMFDF
QHITQFDRGTIKTKDPMVLIATPGMLHGGLSLAVFKEWCEDSRNTIIIPGYCVPGTVGHT
LLKGADVVHIDGKEYDVRCEIQTISFSAHSDHRGILQVLRWVHPDNVVLVHGEEERMRGL
SLEVQNSLSVPCYYPGNQEKLVIHCDVLTKLNIEYPLLNAHKQQYHQNFVSELFGEGKSG
EISGFVYQDWIQESTLLFGCEINASIDEVREKIAGEVLDMVKIEEQTKGMLMITWESEKD
ALVASHFTCFEKSS


>SteCoe_13776(CDS)
ATGTCAATCGAGATCATCCCCCTCGGTGCAGGAAAAGAAGTGGGCCGCAGTTGTATCCTA
GTGAAAATGGCAGGAAGAACCGTAATGTTTGACTGTGGTGTCCATATGGGTTATGATGAT
GAGCGTAGATATCCTTACTTTTCATATCTAGGTAACACAACCGACTATACCCCATTAATC
GATGTTGTTCTAATCACTCATTTCCATCTCGATCACTGTGGAGCCCTTCCTTATTTCACA
GAAATGAAAGGTTATAATGGTCCAGTAATAATGTCAGCACCAACCAGAGCCATTATTCCC
CTTATGCTTGATGACTTTCGTAAAGTCTGTGTCGAACATAAAGGTGAGACTAACTTTTAT
ACTCAAGAACAAATCAAAGAATGTATTAGTAAAGTTCGAACAATAGAATTACATCAAACA
TTAACTATTGGGGATATTAATATTAGAGCTTATTATGCTGGACATGTTTTAGGTGCTGTG
ATGTATTATGTTGAATGTAGAGGACATTCAGTTGTTTATACTGGGGATTATAATGTTGTT
GGGGATAGGCATTTAAGAAGTGCTTGGATTGAAAGATTAGACCCACATGTTGTTATATCA
GAAAGCACTTATGCGACAAAGTTTAGAGAATTGAAAATGAGAAGGGAAAAAGTGTTTTTG
AAGAAAGTTATGCAGACAATAGACAGAGGTGGGAAAGTGCTTATACCTGTTTTTGCACTT
GGTAGAGCTCAAGAGCTTTGCATATTATTAGATACCTACTGGCAAAGAGCACAATTAGAA
TGTGCCGTGCATTTTGCAGGGACTTTAACAGAAAAAGCTAACCAGCTTTATAAAACCTTC
ATCAACTGGTGCAATGAAAACGTCCAAAGAGTATTTCTTTCAAGAAACATGTTTGACTTC
CAACATATAACACAATTCGATAGAGGGACAATAAAAACTAAAGACCCAATGGTCCTTATA
GCAACCCCTGGGATGCTACATGGTGGTTTATCCCTTGCTGTTTTTAAAGAATGGTGTGAA
GATTCTAGAAACACAATAATCATCCCTGGATATTGTGTTCCTGGTACTGTAGGTCATACA
TTATTAAAAGGTGCAGATGTTGTTCATATTGATGGTAAAGAATATGATGTAAGATGTGAA
ATCCAAACAATATCATTTAGTGCTCATTCAGATCATAGAGGAATATTACAAGTTTTACGT
TGGGTACATCCAGATAATGTTGTTTTAGTTCATGGGGAAGAAGAAAGAATGAGAGGTTTA
AGCCTTGAAGTACAAAATTCACTTAGTGTACCTTGTTATTATCCTGGGAATCAAGAAAAA
CTTGTTATTCATTGTGATGTTTTGACTAAGCTTAATATTGAATATCCTTTACTTAATGCT
CATAAACAACAATATCATCAGAATTTTGTTAGTGAACTTTTTGGTGAAGGGAAATCTGGG
GAAATTAGTGGGTTTGTTTATCAGGATTGGATTCAAGAAAGCACTTTATTGTTTGGATGT
GAAATTAATGCTAGTATTGATGAAGTTAGGGAGAAAATTGCTGGGGAGGTTTTGGATATG
GTGAAGATTGAGGAACAGACAAAAGGTATGCTGATGATTACTTGGGAAAGCGAGAAGGAT
GCATTGGTAGCGAGTCATTTTACTTGTTTTGAGAAATCGAGTTAG