Identifiers and Description

Gene Model Identifier

SteCoe_14061

Standard Name

None

Aliases

None

Description

Mito_carr domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22636.0.g491.5400882849875202e-51Mitochondrial carrier protein

Tetrahymena ThermophilaTTHERM_005357401.2479464629129513e-47Mitochondrial carrier protein
WormBaseWBGene000085051.1089390193121365e-40
Saccharomyces CerevisiaeYER053C9.854154686111257e-34Mitochondrial copper and phosp
hate carrier; imports copper a
nd inorganic phosphate into mi
tochondria; functionally redun
dant with Mir1p but less abund
ant than Mir1p under normal co
nditions; expression is induce
d at high temperature

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14061(Protein)
MFRYFLGQPVECAGPSGQGSTGGHDLSYYSKCMLGGVLACGVTHTAVCPLDIVKCNMQAN
YTKFKSMKSSYQALVAESGYSWMKLGWLPTLIGYSLQGFAKFGFYEIFKDVYGGVVGNLF
GQDKAVTFRSVIWATASASAEFFADMLLCPFEAVKVRIQTSPKGTFPETFVPGWNQIKST
EGVNGFYKGIAPLWGRQIPYTIMKFVVFEKVVAIIFEDILKCKRDDCSKSFNLLMTFLSG
YIAGVVCAVVSHPADSLFTAYNKKKTEGAFMEEIKKIYAEMPPGGLWKGLVARIFMVGTL
TGLQWWIYDSWKTACGLKPTGS


>SteCoe_14061(CDS)
ATGTTCAGGTACTTTTTAGGTCAACCAGTTGAGTGTGCGGGCCCAAGTGGTCAAGGCTCA
ACAGGAGGTCATGATCTAAGCTATTATTCAAAATGCATGCTAGGTGGCGTGTTAGCATGT
GGTGTAACACACACTGCAGTTTGTCCTTTAGATATAGTCAAATGCAACATGCAAGCCAAC
TACACTAAATTCAAAAGTATGAAAAGCTCTTATCAAGCCCTAGTTGCAGAAAGTGGCTAT
AGCTGGATGAAACTTGGTTGGCTTCCAACTTTAATTGGGTATTCTCTGCAAGGCTTTGCT
AAATTTGGCTTCTATGAAATCTTTAAGGATGTCTATGGTGGAGTTGTTGGGAATTTATTT
GGACAAGATAAAGCAGTCACTTTTAGATCAGTTATTTGGGCAACAGCGAGCGCTTCGGCA
GAGTTCTTTGCCGACATGCTTCTTTGTCCTTTTGAAGCTGTGAAAGTTAGAATTCAGACT
AGTCCTAAAGGTACATTCCCAGAAACCTTCGTCCCTGGGTGGAATCAAATCAAGTCAACT
GAAGGTGTCAATGGATTCTACAAGGGTATAGCTCCTCTATGGGGAAGGCAAATTCCATAT
ACTATCATGAAGTTTGTTGTCTTTGAAAAAGTTGTTGCGATTATTTTTGAAGATATTCTT
AAGTGCAAAAGAGATGATTGCAGCAAATCTTTCAACCTTCTCATGACTTTCTTATCAGGT
TATATTGCAGGTGTTGTCTGTGCTGTTGTGTCTCATCCAGCAGATTCTCTATTTACTGCT
TATAACAAAAAGAAAACTGAAGGAGCTTTTATGGAAGAGATTAAGAAAATTTATGCTGAA
ATGCCCCCTGGTGGTCTTTGGAAAGGCCTCGTAGCAAGAATATTCATGGTTGGAACATTG
ACTGGACTACAATGGTGGATTTATGACAGTTGGAAGACTGCATGCGGACTGAAGCCAACT
GGCTCATAA