Identifiers and Description

Gene Model Identifier

SteCoe_14097

Standard Name

None

Aliases

None

Description

Tctex-1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10748.0.g62.3195228302435696e-16Tctex-1 family

Tetrahymena ThermophilaTTHERM_005614400.00000000000003442477108469977Light chain subunit of ciliary
two-headed inner arm dynein (
IAD) complex 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14097(Protein)
MKGTNSQENYWTRPSYKEKFCPLKVREIMKNIVEPKLIEEKYQGRTAINQYTYDIAESVR
NALKDEYTNRFKIMVQVVIGEKQGQGVRMGSKCFWDSDTDNVAWFNFMNDSLYCVVIAFA
TYLY


>SteCoe_14097(CDS)
ATGAAAGGTACAAATTCACAAGAGAACTACTGGACCCGCCCATCTTACAAAGAAAAATTT
TGTCCTTTGAAAGTTAGAGAAATTATGAAGAATATTGTTGAACCCAAACTTATTGAAGAG
AAATATCAAGGAAGAACTGCTATAAATCAATATACTTATGATATTGCTGAATCAGTAAGA
AATGCTTTGAAAGATGAGTATACAAATAGGTTTAAGATTATGGTTCAAGTTGTTATTGGA
GAAAAACAAGGACAGGGTGTGAGAATGGGATCGAAGTGCTTTTGGGATTCTGATACTGAT
AATGTTGCTTGGTTTAACTTTATGAATGACTCACTGTATTGTGTTGTTATTGCCTTTGCT
ACTTATCTTTACTAA