Identifiers and Description

Gene Model Identifier

SteCoe_14200

Standard Name

None

Aliases

None

Description

Acetyltransf_16 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16083.0.g1013.532628572200807e-24Touch receptor neuron protein
Mec-17

Tetrahymena ThermophilaTTHERM_003557807.095474162284704e-23alpha-tubulin acetyltransferas
e
WormBaseWBGene000031780.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14200(Protein)
MEFKFDVRRVVRCNNQGIYLLLPQNSLKTKEMCEIIDVMGRESSRSQGLRSIITTAVRFF
SSSDNKIYLKIEGQKVVGILKTGVRKLFYTNEIGKLIEMSPLCLLDFYVHESFQRSGYGK
ELYEYMLQEENTTPNKVPIDRPSAKLIGFMRKHYNLSDYIPQNNNYVIYRQYFSYWDMPV
TRKHEEIKNSGRPASNSQDRGLTNDNERSPNDIKNERNSPYSQERHGTRVENQYQRSPYG
PGSGVRAETQYEKNWPNPQDRSIERDDTKFERRVGLAQAEKILEKHRLLDNSIKKTYAPT
PPWATQTRDVIPGTTSSQYGNYSHRK


>SteCoe_14200(CDS)
ATGGAATTCAAGTTCGATGTTCGCCGAGTCGTTCGATGTAACAATCAAGGGATTTATCTT
TTATTACCACAAAACTCTCTTAAAACCAAAGAAATGTGTGAAATAATCGATGTTATGGGT
CGTGAAAGTTCCCGATCTCAAGGCCTTCGTTCGATAATCACAACTGCAGTTAGGTTTTTT
TCTTCAAGCGACAATAAAATCTACTTGAAAATCGAGGGTCAGAAGGTTGTTGGAATACTC
AAAACAGGTGTGAGGAAGTTGTTTTATACTAACGAGATTGGGAAATTAATAGAAATGTCA
CCTTTGTGTTTGTTAGATTTCTATGTTCATGAGAGTTTTCAAAGGTCAGGATATGGTAAG
GAACTATATGAATATATGCTTCAAGAAGAAAATACTACACCAAATAAAGTGCCGATAGAT
CGTCCATCAGCGAAACTTATAGGGTTTATGCGAAAACATTACAATCTTAGCGATTATATT
CCCCAAAACAACAATTATGTTATTTATCGTCAGTATTTTTCATATTGGGATATGCCTGTG
ACTAGAAAACATGAAGAAATCAAAAACTCAGGACGCCCAGCTTCAAATAGCCAAGACCGT
GGGTTGACAAATGATAATGAACGTAGTCCTAATGATATAAAAAATGAAAGAAACTCACCT
TATAGCCAAGAACGTCATGGGACTAGAGTTGAAAATCAATACCAGAGAAGTCCTTATGGA
CCAGGAAGTGGGGTTAGGGCTGAGACCCAGTATGAGAAAAATTGGCCTAATCCTCAAGAT
AGAAGTATTGAAAGGGATGATACTAAGTTTGAAAGAAGAGTTGGGCTAGCTCAAGCTGAG
AAAATATTAGAAAAGCATAGGCTTTTGGATAATAGCATTAAAAAAACATATGCACCAACA
CCACCTTGGGCTACGCAAACTAGAGATGTAATTCCCGGTACAACATCTTCTCAGTATGGA
AATTATTCTCACAGGAAATAA